![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | PEQU_12448 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 108aa MW: 12303.1 Da PI: 7.7911 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 112.6 | 2.2e-35 | 1 | 78 | 17 | 94 |
NF-YB 17 mkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrele 94
mk+vlP++akisk+ak+t+qec+sefi+f+t+easdkc++e+r+t++g+d+++a+ lG+++y+ + k yl+kyre
PEQU_12448 1 MKQVLPSKAKISKEAKQTMQECASEFIAFITGEASDKCRKENRQTLSGEDICHAMKLLGLDKYACSAKSYLQKYREHC 78
9**************************************************************************964 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 2.1E-32 | 1 | 91 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 1.1E-17 | 1 | 55 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| SuperFamily | SSF47113 | 8.38E-26 | 1 | 87 | IPR009072 | Histone-fold |
| PRINTS | PR00615 | 1.3E-12 | 19 | 37 | No hit | No description |
| PRINTS | PR00615 | 1.3E-12 | 38 | 56 | No hit | No description |
| PRINTS | PR00615 | 1.3E-12 | 57 | 75 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 108 aa Download sequence Send to blast |
MKQVLPSKAK ISKEAKQTMQ ECASEFIAFI TGEASDKCRK ENRQTLSGED ICHAMKLLGL 60 DKYACSAKSY LQKYREHCEK SEAIKNTEPM ETDMTDMLQI YCKGNQHS |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4g91_B | 7e-27 | 1 | 76 | 17 | 92 | Transcription factor HapC (Eurofung) |
| 4g92_B | 7e-27 | 1 | 76 | 17 | 92 | Transcription factor HapC (Eurofung) |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020580614.1 | 1e-75 | transcriptional activator hap3-like | ||||
| Swissprot | O82248 | 8e-32 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
| TrEMBL | A0A2I0XBB5 | 4e-45 | A0A2I0XBB5_9ASPA; Nuclear transcription factor Y subunit B-5 | ||||
| STRING | Pavir.Eb03825.1.p | 9e-35 | (Panicum virgatum) | ||||
| STRING | XP_008796244.1 | 9e-35 | (Phoenix dactylifera) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP2917 | 38 | 87 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G47810.1 | 3e-34 | nuclear factor Y, subunit B5 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




