![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | PEQU_12449 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 95aa MW: 11073 Da PI: 9.9561 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 99.7 | 2.3e-31 | 2 | 86 | 8 | 93 |
NF-YB 8 lPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrel 93
l ian+++imkkvlP +akisk+ake++q+c sef++f+ easdkc++e+r+t+ gdd ++a+ + +++y+ k yl+k+re
PEQU_12449 2 LLIANIGKIMKKVLPPKAKISKKAKEIMQNCPSEFMAFIP-EASDKCHKENRQTLGGDDTYHAMKLIELDKYAFFTKRYLHKHREH 86
679***********************************95.9******************************************96 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 3.6E-27 | 2 | 88 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 5.24E-21 | 2 | 88 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 1.4E-13 | 4 | 64 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 95 aa Download sequence Send to blast |
LLLIANIGKI MKKVLPPKAK ISKKAKEIMQ NCPSEFMAFI PEASDKCHKE NRQTLGGDDT 60 YHAMKLIELD KYAFFTKRYL HKHREHCEKL EATRN |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4g91_B | 2e-22 | 1 | 85 | 7 | 92 | Transcription factor HapC (Eurofung) |
| 4g92_B | 2e-22 | 1 | 85 | 7 | 92 | Transcription factor HapC (Eurofung) |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020580614.1 | 4e-40 | transcriptional activator hap3-like | ||||
| Swissprot | O04027 | 8e-30 | NFYB4_ARATH; Nuclear transcription factor Y subunit B-4 | ||||
| TrEMBL | A0A2I0XBB5 | 2e-32 | A0A2I0XBB5_9ASPA; Nuclear transcription factor Y subunit B-5 | ||||
| STRING | Aquca_003_00805.1 | 8e-31 | (Aquilegia coerulea) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP2917 | 38 | 87 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G09030.1 | 3e-32 | nuclear factor Y, subunit B4 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




