![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | PEQU_12493 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
|
||||||||
| Family | Dof | ||||||||
| Protein Properties | Length: 102aa MW: 11516 Da PI: 11.5929 | ||||||||
| Description | Dof family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | zf-Dof | 122.5 | 1.4e-38 | 37 | 96 | 2 | 61 |
zf-Dof 2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
+e+al+cprC+s+ntkfCy+nnysl+qPr+fCk+CrryWt+GG+lrnvPvGggrr++ ks
PEQU_12493 37 PEAALSCPRCHSNNTKFCYFNNYSLTQPRHFCKTCRRYWTRGGTLRNVPVGGGRRRRSKS 96
67899************************************************9987665 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| ProDom | PD007478 | 5.0E-29 | 21 | 86 | IPR003851 | Zinc finger, Dof-type |
| Pfam | PF02701 | 1.2E-32 | 40 | 95 | IPR003851 | Zinc finger, Dof-type |
| PROSITE profile | PS50884 | 28.584 | 41 | 95 | IPR003851 | Zinc finger, Dof-type |
| PROSITE pattern | PS01361 | 0 | 43 | 79 | IPR003851 | Zinc finger, Dof-type |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0009640 | Biological Process | photomorphogenesis | ||||
| GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0044212 | Molecular Function | transcription regulatory region DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 102 aa Download sequence Send to blast |
TTSDDQQPLP PAGSTGSGPI RPVSMTERAR LAKIPQPEAA LSCPRCHSNN TKFCYFNNYS 60 LTQPRHFCKT CRRYWTRGGT LRNVPVGGGR RRRSKSRESR HL |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. Enhances the DNA binding of OBF transcription factors to OCS elements. {ECO:0000269|PubMed:12887587}. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00407 | DAP | Transfer from AT3G55370 | Download |
| |||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By auxin and salicylic acid (SA). Repressed by jasmonic acid (JA). {ECO:0000269|PubMed:10758484, ECO:0000269|PubMed:12887587}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | Retrieve | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020703512.1 | 3e-50 | dof zinc finger protein DOF2.2 | ||||
| Swissprot | Q9M2U1 | 5e-42 | DOF36_ARATH; Dof zinc finger protein DOF3.6 | ||||
| TrEMBL | A0A2I0WZ50 | 6e-49 | A0A2I0WZ50_9ASPA; Dof zinc finger protein DOF3.6 | ||||
| STRING | XP_006486095.1 | 3e-44 | (Citrus sinensis) | ||||
| STRING | XP_006436002.1 | 3e-44 | (Citrus clementina) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP140 | 37 | 367 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G55370.2 | 2e-39 | OBF-binding protein 3 | ||||




