![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | PEQU_13752 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 127aa MW: 14666.8 Da PI: 8.4617 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 178.3 | 7e-56 | 22 | 115 | 1 | 94 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrele 94
+reqdr+lP+an+srimkk+lP n+ki+kdaket+qecvsefisfvtseas+kcqrekrktingddllwa+atlGfe+y++plk+y++kyre+
PEQU_13752 22 MREQDRYLPVANISRIMKKALPPNGKIAKDAKETMQECVSEFISFVTSEASEKCQREKRKTINGDDLLWAMATLGFEEYIDPLKLYMQKYREVI 115
59******************************************************************************************86 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 2.8E-52 | 19 | 118 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 2.17E-39 | 25 | 121 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 9.8E-29 | 28 | 92 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 1.9E-22 | 56 | 74 | No hit | No description |
| PROSITE pattern | PS00685 | 0 | 59 | 75 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
| PRINTS | PR00615 | 1.9E-22 | 75 | 93 | No hit | No description |
| PRINTS | PR00615 | 1.9E-22 | 94 | 112 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 127 aa Download sequence Send to blast |
LEMSSPGDGC RENGERSPRS NMREQDRYLP VANISRIMKK ALPPNGKIAK DAKETMQECV 60 SEFISFVTSE ASEKCQREKR KTINGDDLLW AMATLGFEEY IDPLKLYMQK YREVISLNNK 120 MKLLRND |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1n1j_A | 2e-49 | 21 | 113 | 1 | 93 | NF-YB |
| 4awl_B | 2e-49 | 21 | 113 | 2 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
| 4csr_A | 2e-49 | 21 | 113 | 2 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020571723.1 | 2e-79 | nuclear transcription factor Y subunit B-1-like | ||||
| Swissprot | Q67XJ2 | 2e-59 | NFYBA_ARATH; Nuclear transcription factor Y subunit B-10 | ||||
| TrEMBL | A0A2I0X8M0 | 3e-74 | A0A2I0X8M0_9ASPA; Nuclear transcription factor Y subunit B-8 | ||||
| STRING | XP_004493942.1 | 6e-67 | (Cicer arietinum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP201 | 38 | 331 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G53340.1 | 9e-62 | nuclear factor Y, subunit B10 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




