PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

PEQU_13851

Organism

Phalaenopsis equestris

Taxonomic ID

78828

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis

Family

WRKY

Protein Properties

Length: 112aa MW: 12988.9 Da PI: 9.884

Description

WRKY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PEQU_13851	genome	BGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	WRKY	100.4	1.1e-31	33	91	1	59
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYGqK+vk+ fprsYYrC++ +C+vkk+v+r ++d vv++tYeg Hnh+ PEQU_13851 33 LDDGYRWRKYGQKKVKNCSFPRSYYRCSQLTCSVKKQVQRLSSDAAVVVTTYEGVHNHP 91 59********************************************************8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:2.20.25.80	3.4E-33	19	91	IPR003657	WRKY domain
SuperFamily	SSF118290	3.66E-28	25	91	IPR003657	WRKY domain
PROSITE profile	PS50811	28.231	28	93	IPR003657	WRKY domain
SMART	SM00774	3.3E-36	33	92	IPR003657	WRKY domain
Pfam	PF03106	1.2E-25	34	91	IPR003657	WRKY domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 112 aa Download sequence Send to blast
MIGGDEKKKG KSEGKKESRP RFVFQTRSES DILDDGYRWR KYGQKKVKNC SFPRSYYRCS 60 QLTCSVKKQV QRLSSDAAVV VTTYEGVHNH PCEILMETLS PLLNQMQFLS QF

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1wj2_A	1e-26	24	90	8	74	Probable WRKY transcription factor 4
2lex_A	1e-26	24	90	8	74	Probable WRKY transcription factor 4
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.
UniProt	Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020574970.1	1e-79	probable WRKY transcription factor 43 isoform X1
Swissprot	Q8GY11	1e-50	WRK43_ARATH; Probable WRKY transcription factor 43
Swissprot	Q9FFS3	6e-50	WRK24_ARATH; Probable WRKY transcription factor 24
TrEMBL	A0A2I0WL06	5e-72	A0A2I0WL06_9ASPA; Putative WRKY transcription factor 43
STRING	XP_010112967.1	1e-55	(Morus notabilis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP1100	38	133

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G46130.1	1e-51	WRKY DNA-binding protein 43

Publications ? help Back to Top
Geilen K,Heilmann M,Hillmer S,Böhmer M WRKY43 regulates polyunsaturated fatty acid content and seed germination under unfavourable growth conditions. Sci Rep, 2017. 7(1): p. 14235 [PMID:29079824]