PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

PEQU_13983

Organism

Phalaenopsis equestris

Taxonomic ID

78828

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis

Family

WRKY

Protein Properties

Length: 131aa MW: 15226.2 Da PI: 10.3901

Description

WRKY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PEQU_13983	genome	BGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	WRKY	104.9	4.2e-33	51	109	1	59
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYGqK vk+s++prsYYrCt+++C+vkk+v+r ++d+++v++tYeg Hnh+ PEQU_13983 51 LDDGYRWRKYGQKAVKNSTHPRSYYRCTHHTCNVKKQVQRLSKDTSIVVTTYEGVHNHP 109 59********************************************************8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:2.20.25.80	4.1E-34	37	109	IPR003657	WRKY domain
SuperFamily	SSF118290	4.05E-29	44	110	IPR003657	WRKY domain
PROSITE profile	PS50811	29.034	46	111	IPR003657	WRKY domain
SMART	SM00774	4.1E-38	51	110	IPR003657	WRKY domain
Pfam	PF03106	1.6E-26	52	109	IPR003657	WRKY domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 131 aa Download sequence Send to blast
MEDQRGEEKE EGEGVNGVGE RREKRKAVSG RGKKVSRPRF AFQTRSANDI LDDGYRWRKY 60 GQKAVKNSTH PRSYYRCTHH TCNVKKQVQR LSKDTSIVVT TYEGVHNHPC EKLMEALSPL 120 LKQIQFLTTR F

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1wj2_A	6e-25	41	108	7	74	Probable WRKY transcription factor 4
2ayd_A	6e-25	39	108	2	71	WRKY transcription factor 1
2lex_A	6e-25	41	108	7	74	Probable WRKY transcription factor 4
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.
UniProt	Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00317	DAP	Transfer from AT2G46130	Download

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020573400.1	1e-94	probable WRKY transcription factor 43
Swissprot	Q8GY11	6e-55	WRK43_ARATH; Probable WRKY transcription factor 43
Swissprot	Q8VWQ4	9e-55	WRK56_ARATH; Probable WRKY transcription factor 56
TrEMBL	A0A2I0WUF1	7e-85	A0A2I0WUF1_9ASPA; Putative WRKY transcription factor 43
STRING	GRMZM2G111354_P01	1e-67	(Zea mays)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP1100	38	133

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G64000.1	6e-57	WRKY DNA-binding protein 56

Publications ? help Back to Top
Geilen K,Heilmann M,Hillmer S,Böhmer M WRKY43 regulates polyunsaturated fatty acid content and seed germination under unfavourable growth conditions. Sci Rep, 2017. 7(1): p. 14235 [PMID:29079824]