![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | PEQU_15464 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
|
||||||||
| Family | GATA | ||||||||
| Protein Properties | Length: 105aa MW: 12034.9 Da PI: 10.2003 | ||||||||
| Description | GATA family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | GATA | 52.2 | 8.2e-17 | 18 | 51 | 1 | 34 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34
C +C + kTp+WR gp g+ktLCnaCG++y + +
PEQU_15464 18 CLHCESHKTPQWRAGPMGPKTLCNACGVRYMSGR 51
99***************************97765 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00401 | 2.4E-11 | 12 | 66 | IPR000679 | Zinc finger, GATA-type |
| PROSITE profile | PS50114 | 10.343 | 12 | 47 | IPR000679 | Zinc finger, GATA-type |
| SuperFamily | SSF57716 | 3.09E-15 | 17 | 75 | No hit | No description |
| Gene3D | G3DSA:3.30.50.10 | 7.5E-14 | 17 | 48 | IPR013088 | Zinc finger, NHR/GATA-type |
| CDD | cd00202 | 1.36E-11 | 17 | 74 | No hit | No description |
| PROSITE pattern | PS00344 | 0 | 18 | 43 | IPR000679 | Zinc finger, GATA-type |
| Pfam | PF00320 | 3.6E-14 | 18 | 50 | IPR000679 | Zinc finger, GATA-type |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0008270 | Molecular Function | zinc ion binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 105 aa Download sequence Send to blast |
MEKTQKSNVV DRDRLKKCLH CESHKTPQWR AGPMGPKTLC NACGVRYMSG RLFPEYRPAT 60 SPKFTPFVHS NSHKKVVEMR QEKANLSSPN GDVAKCELLD YIRNK |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes (By similarity). {ECO:0000250}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020579271.1 | 1e-69 | uncharacterized protein LOC110023949 | ||||
| Refseq | XP_020595248.1 | 2e-74 | GATA transcription factor 4-like | ||||
| Swissprot | Q9SV30 | 1e-35 | GATA8_ARATH; GATA transcription factor 8 | ||||
| TrEMBL | A0A2I0WIN1 | 3e-48 | A0A2I0WIN1_9ASPA; GATA transcription factor 9 | ||||
| STRING | GSMUA_Achr2P02830_001 | 2e-38 | (Musa acuminata) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP5169 | 34 | 51 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G54810.2 | 4e-38 | GATA family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




