PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

PEQU_16171

Organism

Phalaenopsis equestris

Taxonomic ID

78828

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis

Family

MYB

Protein Properties

Length: 180aa MW: 21114.1 Da PI: 10.4642

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PEQU_16171	genome	BGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	62.7	7.4e-20	4	49	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg W +eEde+l+++v++lG+++W+tIa+++ gR++k+c++rw++ PEQU_16171 4 RGHWRPEEDEKLKELVAKLGPHNWNTIAEMLH-GRSGKSCRLRWYNQ 49 899***************************.**********96 PP
2	Myb_DNA-binding	54.9	2e-17	56	99	1	46
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 r ++T+eE+e+l+ ++ +G++ W+ Iar ++ gRt++ +k++w+ PEQU_16171 56 RCPFTEEEEERLLASHRIHGNR-WSIIARLFP-GRTDNAVKNHWHV 99 679*****************.*****.*********96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	26.41	1	54	IPR017930	Myb domain
SMART	SM00717	2.3E-16	3	52	IPR001005	SANT/Myb domain
Pfam	PF00249	7.8E-19	4	50	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	1.83E-30	4	97	IPR009057	Homeodomain-like
Gene3D	G3DSA:1.10.10.60	1.4E-26	5	57	IPR009057	Homeodomain-like
CDD	cd00167	7.88E-14	7	48	No hit	No description
PROSITE profile	PS51294	21.561	55	105	IPR017930	Myb domain
SMART	SM00717	5.1E-15	55	103	IPR001005	SANT/Myb domain
Pfam	PF00249	3.4E-14	56	98	IPR001005	SANT/Myb domain
CDD	cd00167	6.54E-11	58	98	No hit	No description
Gene3D	G3DSA:1.10.10.60	1.2E-20	58	103	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 180 aa Download sequence Send to blast
MCTRGHWRPE EDEKLKELVA KLGPHNWNTI AEMLHGRSGK SCRLRWYNQL DPRINRCPFT 60 EEEEERLLAS HRIHGNRWSI IARLFPGRTD NAVKNHWHVI MARRSRERSK LQPKQSSISP 120 ESHVIRKERK EKMNFEFPKG LLFSSLIGGR HGGTLCGFNH PISQSQGEYS YWPVIHEGKN

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	3e-32	2	104	5	107	B-MYB
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that confers sensitivity to abscisic acid (ABA) and salt, but tolerance to drought (PubMed:21399993). Regulates secondary cell wall (SCW) biosynthesis, especially in interfascicular and xylary fibers (PubMed:18952777, PubMed:23781226). {ECO:0000269\|PubMed:18952777, ECO:0000269\|PubMed:21399993, ECO:0000269\|PubMed:23781226}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By abscisic acid (PubMed:16463103, PubMed:21399993). Accumulates in response to salt (PubMed:21399993). Triggered by MYB46 and MYB83 in the regulation of secondary cell wall biosynthesis (PubMed:19674407, PubMed:22197883). {ECO:0000269\|PubMed:16463103, ECO:0000269\|PubMed:19674407, ECO:0000269\|PubMed:21399993, ECO:0000269\|PubMed:22197883}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AF485906	1e-41	AF485906.1 Dendrobium sp. XMW-2002-15 MYB15 (MYB15) mRNA, partial cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020576276.1	1e-131	transcription factor MYB52-like isoform X1
Swissprot	Q6R0C4	3e-69	MYB52_ARATH; Transcription factor MYB52
TrEMBL	A0A455LA98	1e-109	A0A455LA98_9ASPA; Transcription factor MYB52-like protein
STRING	POPTR_0015s05130.1	2e-70	(Populus trichocarpa)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP294	38	260

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G17950.1	1e-71	myb domain protein 52

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Cassan-Wang H, et al. Identification of novel transcription factors regulating secondary cell wall formation in Arabidopsis. Front Plant Sci, 2013. 4: p. 189 [PMID:23781226] Shi D, et al. MYB52 Negatively Regulates Pectin Demethylesterification in Seed Coat Mucilage. Plant Physiol., 2018. 176(4): p. 2737-2749 [PMID:29440562]