PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

PEQU_16914

Organism

Phalaenopsis equestris

Taxonomic ID

78828

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis

Family

WRKY

Protein Properties

Length: 103aa MW: 12039.4 Da PI: 9.3596

Description

WRKY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PEQU_16914	genome	BGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	WRKY	94.5	7.5e-30	20	78	1	59
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYG+K+vk+s++ r+YYrC++ gC vkk+ver++edp+++++tYeg Hnh+ PEQU_16914 20 LDDGYKWRKYGKKSVKNSRNLRNYYRCSTDGCLVKKRVERDHEDPSYLVTTYEGIHNHT 78 59********************************************************7 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:2.20.25.80	1.2E-30	7	80	IPR003657	WRKY domain
SuperFamily	SSF118290	4.32E-27	13	80	IPR003657	WRKY domain
PROSITE profile	PS50811	27.795	15	80	IPR003657	WRKY domain
SMART	SM00774	7.6E-33	20	79	IPR003657	WRKY domain
Pfam	PF03106	1.4E-23	21	77	IPR003657	WRKY domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 103 aa Download sequence Send to blast
PRMEEGSRIA FRIQTDVENL DDGYKWRKYG KKSVKNSRNL RNYYRCSTDG CLVKKRVERD 60 HEDPSYLVTT YEGIHNHTSP GIVYYAKQDS VSGRFHLSGS WSC

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
2ayd_A	6e-23	7	80	1	74	WRKY transcription factor 1
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). Involved in defense responses. May act as positive regulator of salicylic acid (SA)-mediated signaling and negative regulator of jasmonic acid (JA)-mediated signaling (PubMed:21030507). {ECO:0000250, ECO:0000269\|PubMed:21030507}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020591476.1	8e-74	probable WRKY transcription factor 51 isoform X1
Refseq	XP_020591477.1	8e-74	probable WRKY transcription factor 51 isoform X2
Swissprot	Q93WU9	7e-34	WRK51_ARATH; Probable WRKY transcription factor 51
TrEMBL	A0A2I0VXJ6	1e-60	A0A2I0VXJ6_9ASPA; Putative WRKY transcription factor 51
STRING	XP_008810071.1	1e-50	(Phoenix dactylifera)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP441	37	206

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G64810.1	3e-36	WRKY DNA-binding protein 51

Publications ? help Back to Top
Yan C, et al. Injury Activates Ca2+/Calmodulin-Dependent Phosphorylation of JAV1-JAZ8-WRKY51 Complex for Jasmonate Biosynthesis. Mol. Cell, 2018. 70(1): p. 136-149.e7 [PMID:29625034]