PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

PEQU_17923

Organism

Phalaenopsis equestris

Taxonomic ID

78828

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis

Family

DBB

Protein Properties

Length: 161aa MW: 18004.6 Da PI: 7.0188

Description

DBB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PEQU_17923	genome	BGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	zf-B_box	21.1	6.4e-07	4	45	5	40
zf-B_box 5 kCpeHeekelqlfCedCqqllCedClleeHkg......Htvv 40 C+ ++ + ++ C ++ lC+ C + H+ H++v PEQU_17923 4 QCDVCGVETASVLCYADEAALCRRCDEGVHSAnklagkHRRV 45 7***999*******************667888888766 PP
2	zf-B_box	25.5	2.7e-08	55	87	3	35
zf-B_box 3 erkCpeHeekelqlfCedCqqllCedClleeHk 35 + C+ ++ek+ fC+d + lC+dC +++H PEQU_17923 55 LPLCDICKEKKGFVFCQDERAILCKDCDFQIHA 87 579*****************************5 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50119	9.627	1	47	IPR000315	B-box-type zinc finger
SMART	SM00336	1.5E-11	1	47	IPR000315	B-box-type zinc finger
Pfam	PF00643	4.5E-6	4	45	IPR000315	B-box-type zinc finger
CDD	cd00021	9.18E-7	5	47	No hit	No description
SMART	SM00336	3.6E-8	53	100	IPR000315	B-box-type zinc finger
PROSITE profile	PS50119	8.631	53	95	IPR000315	B-box-type zinc finger
Pfam	PF00643	1.7E-5	55	87	IPR000315	B-box-type zinc finger
CDD	cd00021	1.05E-6	56	87	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0005622	Cellular Component	intracellular
GO:0008270	Molecular Function	zinc ion binding

Sequence ? help Back to Top
Protein Sequence Length: 161 aa Download sequence Send to blast
MKLQCDVCGV ETASVLCYAD EAALCRRCDE GVHSANKLAG KHRRVFLLPH PLRTLPLCDI 60 CKEKKGFVFC QDERAILCKD CDFQIHATNT NTSKHMRFLF SGIRLSTTPI PSAFSSTTEN 120 DNSCRSTISD YLMNMLPGWR VDDFLFDDVA STGNFSGCHL V

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator that acts as positive regulator of seedling photomorphogenesis (PubMed:17965270). Acts downstream of COP1 and play an important role in early and long-term adjustment of the shade avoidance syndrome (SAS) responses in natural environments (PubMed:21070414). {ECO:0000269\|PubMed:17965270, ECO:0000269\|PubMed:21070414}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020592557.1	1e-118	B-box zinc finger protein 21-like
Swissprot	Q9LQZ7	5e-42	BBX21_ARATH; B-box zinc finger protein 21
TrEMBL	A0A2I0VF23	3e-70	A0A2I0VF23_9ASPA; Putative salt tolerance-like protein
STRING	GSMUA_Achr11P21780_001	4e-53	(Musa acuminata)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP2392	36	79

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G75540.1	2e-44	salt tolerance homolog2

Publications ? help Back to Top
Xu D, et al. BBX21, an Arabidopsis B-box protein, directly activates HY5 and is targeted by COP1 for 26S proteasome-mediated degradation. Proc. Natl. Acad. Sci. U.S.A., 2016. 113(27): p. 7655-60 [PMID:27325768] Xu DB, et al. The G-Protein β Subunit AGB1 Promotes Hypocotyl Elongation through Inhibiting Transcription Activation Function of BBX21 in Arabidopsis. Mol Plant, 2017. 10(9): p. 1206-1223 [PMID:28827171] Xu D,Jiang Y,Li J,Holm M,Deng XW The B-Box Domain Protein BBX21 Promotes Photomorphogenesis. Plant Physiol., 2018. 176(3): p. 2365-2375 [PMID:29259103] Job N,Yadukrishnan P,Bursch K,Datta S,Johansson H Two B-Box Proteins Regulate Photomorphogenesis by Oppositely Modulating HY5 through their Diverse C-Terminal Domains. Plant Physiol., 2018. 176(4): p. 2963-2976 [PMID:29439209] Crocco CD,Ocampo GG,Ploschuk EL,Mantese A,Botto JF Heterologous Expression of AtBBX21 Enhances the Rate of Photosynthesis and Alleviates Photoinhibition in Solanumtuberosum. Plant Physiol., 2018. 177(1): p. 369-380 [PMID:29555784] Kang X, et al. HRB2 and BBX21 interaction modulates Arabidopsis ABI5 locus and stomatal aperture. Plant Cell Environ., 2018. 41(8): p. 1912-1925 [PMID:29748960]