 |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | PEQU_18567 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
|
||||||||
| Family | FAR1 | ||||||||
| Protein Properties | Length: 65aa MW: 7703.1 Da PI: 10.6285 | ||||||||
| Description | FAR1 family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | FAR1 | 25 | 6.2e-08 | 2 | 62 | 11 | 72 |
FAR1 11 GFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkek 72
Fsvrk+++ ++++ ++++fvC k ++++ k + e+ + +++ tr C a+++ + ++
PEQU_18567 2 RFSVRKEHTIFWPNSKNLKTKDFVCGKASFKKNMKIT-ETVKYKKVDTRLVCLAMIRYTIDD 62
7**********99********************9988.999999************988765 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF03101 | 6.8E-5 | 3 | 62 | IPR004330 | FAR1 DNA binding domain |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 65 aa Download sequence Send to blast |
MRFSVRKEHT IFWPNSKNLK TKDFVCGKAS FKKNMKITET VKYKKVDTRL VCLAMIRYTI 60 DDQGN |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020589909.1 | 2e-23 | uncharacterized protein LOC110031142 | ||||
| Refseq | XP_020598366.1 | 2e-24 | putative protein FAR1-RELATED SEQUENCE 10 | ||||
| TrEMBL | A0A2I0VFB6 | 2e-16 | A0A2I0VFB6_9ASPA; Protein FAR1-RELATED SEQUENCE 5 | ||||
| TrEMBL | A0A2I0VS86 | 2e-16 | A0A2I0VS86_9ASPA; Protein FAR1-RELATED SEQUENCE 5 | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP1212 | 5 | 87 |
| ©2010-2022, Center
for Bioinformatics, Peking University Last Modified: 2022-12-08 Questions or Comments, please contact  |
Supported By
|