![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | PEQU_19415 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
|
||||||||
| Family | Nin-like | ||||||||
| Protein Properties | Length: 63aa MW: 7399.99 Da PI: 11.6964 | ||||||||
| Description | Nin-like family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | RWP-RK | 65.3 | 9.5e-21 | 1 | 37 | 16 | 52 |
RWP-RK 16 lpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52
+pi++AAk+L+v++T+LK++CR+++I+RWP+Rki+s+
PEQU_19415 1 MPINKAAKKLNVGVTLLKKRCREMNIRRWPYRKIRSV 37
79*********************************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51519 | 14.015 | 1 | 58 | IPR003035 | RWP-RK domain |
| Pfam | PF02042 | 3.8E-18 | 1 | 37 | IPR003035 | RWP-RK domain |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 63 aa Download sequence Send to blast |
MPINKAAKKL NVGVTLLKKR CREMNIRRWP YRKIRSVETL IQNIKVLHPF PILFHSNSCL 60 LAT |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Putative transcription factor. {ECO:0000250}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_019199919.1 | 3e-18 | PREDICTED: protein RKD1-like | ||||
| Swissprot | Q9CA66 | 6e-16 | RKD2_ARATH; Protein RKD2 | ||||
| TrEMBL | A0A2I0WDX6 | 5e-17 | A0A2I0WDX6_9ASPA; Protein RKD3 | ||||
| STRING | XP_006477595.1 | 1e-16 | (Citrus sinensis) | ||||
| STRING | XP_009778708.1 | 2e-16 | (Nicotiana sylvestris) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP4590 | 33 | 65 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G74480.1 | 2e-18 | RWP-RK domain-containing protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




