![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | PEQU_22909 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
|
||||||||
| Family | ERF | ||||||||
| Protein Properties | Length: 105aa MW: 11240 Da PI: 4.2076 | ||||||||
| Description | ERF family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | AP2 | 48.9 | 1.6e-15 | 3 | 44 | 12 | 55 |
AP2 12 rgrWvAeIrdpsengkrkrfslgkfgtaeeAakaaiaarkkleg 55
+g++vAeIrd s++g r +lg+f+taeeAa+a+++a+ +l+g
PEQU_22909 3 WGKFVAEIRD-STRG-GVRLWLGTFDTAEEAARAYDRAAAALRG 44
9*********.3433.4*************************98 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51032 | 18.373 | 1 | 52 | IPR001471 | AP2/ERF domain |
| SuperFamily | SSF54171 | 1.44E-18 | 2 | 53 | IPR016177 | DNA-binding domain |
| SMART | SM00380 | 9.1E-24 | 2 | 58 | IPR001471 | AP2/ERF domain |
| Gene3D | G3DSA:3.30.730.10 | 5.1E-24 | 3 | 52 | IPR001471 | AP2/ERF domain |
| Pfam | PF00847 | 1.5E-9 | 3 | 44 | IPR001471 | AP2/ERF domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 105 aa Download sequence Send to blast |
XXWGKFVAEI RDSTRGGVRL WLGTFDTAEE AARAYDRAAA ALRGQLAILN FPGEVPISAT 60 TGITTSTATG SSETASRPEA GRGEQVIELE CLDDKLLEDL LYVGE |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5wx9_A | 4e-25 | 3 | 96 | 23 | 114 | Ethylene-responsive transcription factor ERF096 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probably acts as a transcriptional activator. Binds to the GCC-box pathogenesis-related promoter element. May be involved in the regulation of gene expression by stress factors and by components of stress signal transduction pathways (By similarity). {ECO:0000250}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020580450.1 | 4e-61 | ethylene-responsive transcription factor ERF096-like | ||||
| Swissprot | Q9LTC5 | 1e-27 | ERF98_ARATH; Ethylene-responsive transcription factor ERF098 | ||||
| TrEMBL | A0A2I0X699 | 3e-37 | A0A2I0X699_9ASPA; Ethylene-responsive transcription factor ERF098 | ||||
| STRING | XP_010039174.1 | 2e-32 | (Eucalyptus grandis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP277 | 37 | 249 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G23230.1 | 6e-16 | ERF family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




