PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

PEQU_23086

Organism

Phalaenopsis equestris

Taxonomic ID

78828

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis

Family

M-type_MADS

Protein Properties

Length: 54aa MW: 6040.29 Da PI: 11.0128

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PEQU_23086	genome	BGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	66.5	2.6e-21	8	52	1	45
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45 k ie+ s r v fskRr+g++KKAeEL +LC+a+vav++fs+ g+ PEQU_23086 8 KLIESASARMVCFSKRRKGLFKKAEELLILCGAKVAVLVFSQAGR 52 569***************************************996 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	2.4E-18	1	54	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	2.62E-20	1	54	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	22.483	1	54	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	4.9E-17	2	22	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	1.4E-23	10	54	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	4.9E-17	22	37	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	4.9E-17	37	54	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 54 aa Download sequence Send to blast
GRKKLENKLI ESASARMVCF SKRRKGLFKK AEELLILCGA KVAVLVFSQA GRPY

Functional Description ? help Back to Top
Source	Description
UniProt	MADS-box transcription factor that acts with AGL42 and AGL71 in the control of flowering time. Promotes flowering at the shoot apical and axillary meristems. Seems to act through a gibberellin-dependent pathway. Interacts genetically with SOC1 and its expression is directly regulated by SOC1. {ECO:0000269\|PubMed:21609362}.
UniProt	MADS-box transcription factor that acts with AGL42 and AGL72 in the control of flowering time. Promotes flowering at the shoot apical and axillary meristems. Seems to act through a gibberellin-dependent pathway. Interacts genetically with SOC1 and its expression is directly regulated by SOC1. {ECO:0000269\|PubMed:21609362}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020591382.1	4e-25	MADS-box transcription factor 23-like
Swissprot	Q9FLH5	2e-14	AGL72_ARATH; MADS-box protein AGL72
Swissprot	Q9LT93	1e-14	AGL71_ARATH; MADS-box protein AGL71
TrEMBL	A0A2I0X9C1	4e-22	A0A2I0X9C1_9ASPA; MADS-box protein ZMM17
TrEMBL	A0A2I0X9D2	7e-21	A0A2I0X9D2_9ASPA; Floral homeotic protein GLOBOSA
STRING	XP_008788342.1	1e-17	(Phoenix dactylifera)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP129	38	398

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G51870.1	6e-17	AGAMOUS-like 71

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546]