![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | PEQU_25615 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
|
||||||||
| Family | GATA | ||||||||
| Protein Properties | Length: 81aa MW: 9313.66 Da PI: 10.882 | ||||||||
| Description | GATA family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | GATA | 59.8 | 3.4e-19 | 4 | 38 | 1 | 35 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
C++C + kTp+WR gp g+k+LCnaCG+++++ +l
PEQU_25615 4 CTHCASDKTPQWRTGPLGPKSLCNACGVRFKSGRL 38
*******************************9886 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50114 | 11.477 | 1 | 34 | IPR000679 | Zinc finger, GATA-type |
| SuperFamily | SSF57716 | 9.98E-15 | 2 | 62 | No hit | No description |
| SMART | SM00401 | 1.4E-12 | 2 | 48 | IPR000679 | Zinc finger, GATA-type |
| Gene3D | G3DSA:3.30.50.10 | 2.9E-14 | 2 | 36 | IPR013088 | Zinc finger, NHR/GATA-type |
| CDD | cd00202 | 1.31E-11 | 3 | 50 | No hit | No description |
| Pfam | PF00320 | 2.9E-17 | 4 | 38 | IPR000679 | Zinc finger, GATA-type |
| PROSITE pattern | PS00344 | 0 | 4 | 29 | IPR000679 | Zinc finger, GATA-type |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0008270 | Molecular Function | zinc ion binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 81 aa Download sequence Send to blast |
MRRCTHCASD KTPQWRTGPL GPKSLCNACG VRFKSGRLVP EYRPAASPTF VLTQHSNSHR 60 KVLELRRQRE NAAIYNEYNV R |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes. {ECO:0000269|PubMed:12139008}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020589285.1 | 6e-55 | GATA transcription factor 4-like | ||||
| Swissprot | O49741 | 7e-44 | GATA2_ARATH; GATA transcription factor 2 | ||||
| TrEMBL | A0A078FX08 | 4e-42 | A0A078FX08_BRANA; GATA transcription factor | ||||
| TrEMBL | A0A0D3BQ03 | 4e-42 | A0A0D3BQ03_BRAOL; GATA transcription factor | ||||
| TrEMBL | A0A397Z6P8 | 3e-42 | A0A397Z6P8_BRACM; GATA transcription factor | ||||
| TrEMBL | M4CL00 | 3e-42 | M4CL00_BRARP; GATA transcription factor | ||||
| STRING | Bra004886.1-P | 6e-43 | (Brassica rapa) | ||||
| STRING | Bo4g024310.1 | 6e-43 | (Brassica oleracea) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP4621 | 29 | 55 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G45050.1 | 3e-46 | GATA transcription factor 2 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




