![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | PEQU_27072 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
|
||||||||
| Family | ZF-HD | ||||||||
| Protein Properties | Length: 103aa MW: 11113.2 Da PI: 8.5939 | ||||||||
| Description | ZF-HD family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | ZF-HD_dimer | 101.1 | 7.9e-32 | 26 | 82 | 2 | 59 |
ZF-HD_dimer 2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59
++v+Y+eC+kNhAas+Gg+avDGC+Efm+s geegt+aal+CaAC+CHR+FH+re +
PEQU_27072 26 SAVKYRECRKNHAASIGGYAVDGCREFMAS-GEEGTTAALHCAACNCHRSFHKREADV 82
689**************************9.999********************9875 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| ProDom | PD125774 | 1.0E-19 | 26 | 83 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| Pfam | PF04770 | 1.1E-29 | 28 | 80 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| TIGRFAMs | TIGR01566 | 2.0E-26 | 29 | 79 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| PROSITE profile | PS51523 | 25.819 | 30 | 79 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 103 aa Download sequence Send to blast |
MRSQPKPPTS SPNSNSPSRK KETKCSAVKY RECRKNHAAS IGGYAVDGCR EFMASGEEGT 60 TAALHCAACN CHRSFHKREA DVEPPSICDC SSDSNSTSSS SRR |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Inhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. {ECO:0000269|PubMed:21455630}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020587987.1 | 1e-69 | mini zinc finger protein 1-like | ||||
| Swissprot | Q9LJW5 | 2e-28 | MIF2_ARATH; Mini zinc finger protein 2 | ||||
| TrEMBL | A0A2I0WEX2 | 6e-45 | A0A2I0WEX2_9ASPA; ZF-HD homeobox protein | ||||
| STRING | XP_008792497.1 | 4e-34 | (Phoenix dactylifera) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP1431 | 34 | 120 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G74660.1 | 1e-27 | mini zinc finger 1 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




