![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | PEQU_27822 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
|
||||||||
| Family | WRKY | ||||||||
| Protein Properties | Length: 82aa MW: 9822.13 Da PI: 9.0182 | ||||||||
| Description | WRKY family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | WRKY | 78.6 | 7.1e-25 | 1 | 58 | 2 | 59 |
--SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
WRKY 2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
dD+y+W+KYGqK +kg + rsY++C ++C +kkkve ++dp+ +ei YegeHnh+
PEQU_27822 1 DDEYEWKKYGQKYIKGIKKYRSYFKCKNKNCGAKKKVEWPTNDPNNIEILYEGEHNHR 58
7********************************************************6 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF118290 | 5.36E-22 | 1 | 58 | IPR003657 | WRKY domain |
| PROSITE profile | PS50811 | 22.068 | 1 | 60 | IPR003657 | WRKY domain |
| SMART | SM00774 | 2.8E-20 | 1 | 59 | IPR003657 | WRKY domain |
| Gene3D | G3DSA:2.20.25.80 | 2.7E-23 | 1 | 58 | IPR003657 | WRKY domain |
| Pfam | PF03106 | 3.6E-22 | 1 | 58 | IPR003657 | WRKY domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 82 aa Download sequence Send to blast |
DDEYEWKKYG QKYIKGIKKY RSYFKCKNKN CGAKKKVEWP TNDPNNIEIL YEGEHNHRVI 60 IALELEEANK YDLATQMFGS RT |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1wj2_A | 7e-16 | 1 | 57 | 18 | 74 | Probable WRKY transcription factor 4 |
| 2lex_A | 7e-16 | 1 | 57 | 18 | 74 | Probable WRKY transcription factor 4 |
| Search in ModeBase | ||||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020595991.1 | 1e-34 | probable WRKY transcription factor 26 isoform X1 | ||||
| TrEMBL | A0A2I0VZV9 | 3e-29 | A0A2I0VZV9_9ASPA; Putative WRKY transcription factor 3 | ||||
| STRING | OS03T0657400-00 | 2e-23 | (Oryza sativa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP10158 | 34 | 44 |




