![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | PEQU_30689 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 103aa MW: 12089.3 Da PI: 9.9122 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 102 | 2.1e-32 | 16 | 66 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+iifss+g+lyey++
PEQU_30689 16 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIIFSSRGRLYEYAN 66
79***********************************************85 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00432 | 1.2E-42 | 8 | 67 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 34.034 | 8 | 68 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 9.46E-39 | 9 | 67 | No hit | No description |
| SuperFamily | SSF55455 | 1.96E-30 | 9 | 68 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 7.4E-34 | 10 | 30 | IPR002100 | Transcription factor, MADS-box |
| PROSITE pattern | PS00350 | 0 | 10 | 64 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 2.4E-27 | 17 | 64 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 7.4E-34 | 30 | 45 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 7.4E-34 | 45 | 66 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 103 aa Download sequence Send to blast |
MMESKEKMGR GKIEIKRIEN TTNRQVTFCK RRNGLLKKAY ELSVLCDAEV ALIIFSSRGR 60 LYEYANNRFI LLSLSISLLS LSLPLFLPKV FFFIFEDFER LND |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1tqe_P | 2e-21 | 8 | 67 | 1 | 60 | Myocyte-specific enhancer factor 2B |
| 1tqe_Q | 2e-21 | 8 | 67 | 1 | 60 | Myocyte-specific enhancer factor 2B |
| 1tqe_R | 2e-21 | 8 | 67 | 1 | 60 | Myocyte-specific enhancer factor 2B |
| 1tqe_S | 2e-21 | 8 | 67 | 1 | 60 | Myocyte-specific enhancer factor 2B |
| 6c9l_A | 2e-21 | 8 | 67 | 1 | 60 | Myocyte-specific enhancer factor 2B |
| 6c9l_B | 2e-21 | 8 | 67 | 1 | 60 | Myocyte-specific enhancer factor 2B |
| 6c9l_C | 2e-21 | 8 | 67 | 1 | 60 | Myocyte-specific enhancer factor 2B |
| 6c9l_D | 2e-21 | 8 | 67 | 1 | 60 | Myocyte-specific enhancer factor 2B |
| 6c9l_E | 2e-21 | 8 | 67 | 1 | 60 | Myocyte-specific enhancer factor 2B |
| 6c9l_F | 2e-21 | 8 | 67 | 1 | 60 | Myocyte-specific enhancer factor 2B |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor. Interacts genetically with TT16/AGL32 in a partially antagonistic manner during flower development. Is essential for the coordination of cell divisions in ovule, seed coat development and endosperm formation (PubMed:27776173). {ECO:0000269|PubMed:27776173}. | |||||
| UniProt | Probable transcription factor. Interacts genetically with TT16/AGL32 in a partially antagonistic manner during flower development. Is essential for the coordination of cell divisions in ovule, seed coat development and endosperm formation (PubMed:27776173). {ECO:0000269|PubMed:27776173}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | GU123627 | 3e-71 | GU123627.1 Cymbidium ensifolium MADS-box factor MADS2 mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020582512.1 | 2e-41 | floral homeotic protein AGAMOUS-like | ||||
| Refseq | XP_020591800.1 | 2e-41 | floral homeotic protein AGAMOUS-like | ||||
| Swissprot | P29381 | 2e-37 | AGL1_ARATH; Agamous-like MADS-box protein AGL1 | ||||
| Swissprot | P29385 | 1e-37 | AGL5_ARATH; Agamous-like MADS-box protein AGL5 | ||||
| TrEMBL | A0A1Z1VX67 | 4e-40 | A0A1Z1VX67_9ASPA; AGAMOUS-like protein | ||||
| STRING | XP_007146364.1 | 1e-38 | (Phaseolus vulgaris) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP129 | 38 | 398 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G58780.2 | 2e-40 | MIKC_MADS family protein | ||||




