![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | PEQU_31486 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
|
||||||||
| Family | B3 | ||||||||
| Protein Properties | Length: 65aa MW: 7519.78 Da PI: 7.9254 | ||||||||
| Description | B3 family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | B3 | 31.8 | 2.4e-10 | 3 | 54 | 45 | 98 |
EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
B3 45 sWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98
W v + k+ + + + +GW +F+kan+++ gD++ F+l+++ e +++v++ +
PEQU_31486 3 CWPVLY--HKSNSFVGFLGGWVDFAKANNICRGDICEFELINKLEYKFRVQIMK 54
599999..88888888889*********************99877778888876 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50863 | 11.406 | 1 | 56 | IPR003340 | B3 DNA binding domain |
| SuperFamily | SSF101936 | 2.55E-12 | 2 | 54 | IPR015300 | DNA-binding pseudobarrel domain |
| Gene3D | G3DSA:2.40.330.10 | 4.1E-11 | 2 | 57 | IPR015300 | DNA-binding pseudobarrel domain |
| CDD | cd10017 | 2.63E-8 | 2 | 52 | No hit | No description |
| Pfam | PF02362 | 1.4E-7 | 3 | 54 | IPR003340 | B3 DNA binding domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 65 aa Download sequence Send to blast |
MRCWPVLYHK SNSFVGFLGG WVDFAKANNI CRGDICEFEL INKLEYKFRV QIMKAEGSIC 60 DEKVA |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020590305.1 | 2e-42 | B3 domain-containing protein Os01g0905400-like | ||||
| Refseq | XP_020590306.1 | 2e-42 | B3 domain-containing protein Os01g0905400-like | ||||
| TrEMBL | A0A2I0X2J5 | 1e-26 | A0A2I0X2J5_9ASPA; B3 domain-containing protein | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP11461 | 32 | 40 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G18090.1 | 2e-07 | B3 family protein | ||||




