PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

PEQU_32690

Organism

Phalaenopsis equestris

Taxonomic ID

78828

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis

Family

WRKY

Protein Properties

Length: 99aa MW: 11830.3 Da PI: 9.9905

Description

WRKY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PEQU_32690	genome	BGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	WRKY	93.9	1.2e-29	31	88	1	58
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnh 58 ldDgy+WrKYG+K+vk+s +pr+YYrC+++gC+vkk++er +ed +v++ Yeg Hnh PEQU_32690 31 LDDGYKWRKYGKKMVKSSSNPRNYYRCSMEGCNVKKRIERMEEDSGYVITSYEGIHNH 88 59******************************************************** PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:2.20.25.80	6.9E-31	16	89	IPR003657	WRKY domain
SuperFamily	SSF118290	9.81E-27	24	89	IPR003657	WRKY domain
PROSITE profile	PS50811	27.6	26	91	IPR003657	WRKY domain
SMART	SM00774	6.6E-31	31	90	IPR003657	WRKY domain
Pfam	PF03106	2.2E-22	32	88	IPR003657	WRKY domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 99 aa Download sequence Send to blast
WMCRNTNMQQ SNQRLKKTKV SFKTKSDRDV LDDGYKWRKY GKKMVKSSSN PRNYYRCSME 60 GCNVKKRIER MEEDSGYVIT SYEGIHNHYA LNQHDYSGT

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1wj2_A	2e-23	22	88	8	74	Probable WRKY transcription factor 4
2lex_A	2e-23	22	88	8	74	Probable WRKY transcription factor 4
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020598279.1	1e-65	probable WRKY transcription factor 50
Swissprot	Q8VWQ5	1e-32	WRK50_ARATH; Probable WRKY transcription factor 50
TrEMBL	A0A2P1JML1	5e-53	A0A2P1JML1_9ASPA; WRKY transcription factor 50-like (Fragment)
STRING	Traes_3B_E408A7B56.1	2e-34	(Triticum aestivum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP441	37	206

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G26170.1	6e-35	WRKY DNA-binding protein 50

Publications ? help Back to Top
Brand LH,Kirchler T,Hummel S,Chaban C,Wanke D DPI-ELISA: a fast and versatile method to specify the binding of plant transcription factors to DNA in vitro. Plant Methods, 2010. 6: p. 25 [PMID:21108821]