PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PEQU_34009
Organism
Phalaenopsis equestris
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
Family NAC
Protein Properties Length: 76aa    MW: 8853.32 Da    PI: 10.5424
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PEQU_34009genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM821.2e-2525673128
         NAM  73 rknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                 r+nrat++gyWk+tgkdke+++  g lvg+kktLvfykgrapkgekt+Wvmheyrl
  PEQU_34009   2 RTNRATNAGYWKTTGKDKEIFH-YGVLVGMKKTLVFYKGRAPKGEKTSWVMHEYRL 56 
                 89********************.999*****************************8 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100527.374174IPR003441NAC domain
SuperFamilySSF1019411.26E-26265IPR003441NAC domain
PfamPF023651.1E-12356IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 76 aa     Download sequence    Send to blast
MRTNRATNAG YWKTTGKDKE IFHYGVLVGM KKTLVFYKGR APKGEKTSWV MHEYRLQTDF  60
PYKSSKVLIL LSYLSS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A4e-1825691145NAC domain-containing protein 19
3swm_B4e-1825691145NAC domain-containing protein 19
3swm_C4e-1825691145NAC domain-containing protein 19
3swm_D4e-1825691145NAC domain-containing protein 19
3swp_A4e-1825691145NAC domain-containing protein 19
3swp_B4e-1825691145NAC domain-containing protein 19
3swp_C4e-1825691145NAC domain-containing protein 19
3swp_D4e-1825691145NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtBinds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269|PubMed:27021284}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020592905.18e-43NAC domain-containing protein 100-like
SwissprotQ9FK441e-27NAC87_ARATH; NAC domain-containing protein 87
TrEMBLA0A2H3YF561e-35A0A2H3YF56_PHODC; NAC domain-containing protein 79
STRINGXP_008797830.12e-36(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP79193450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18400.11e-33NAC domain containing protein 58
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]