PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PEQU_37410
Organism
Phalaenopsis equestris
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
Family Dof
Protein Properties Length: 76aa    MW: 8929.06 Da    PI: 9.7563
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PEQU_37410genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof84.97.7e-27456557
      zf-Dof  5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrk 57
                 ++cprC+s++t+fCy+nny+++qPr++Ck C++yWt+GG+lr +   +g+r+
  PEQU_37410  4 RRACPRCHSRETRFCYFNNYNVNQPRHYCKLCHQYWTAGGTLRKLRRNAGSRR 56
                679*****************************************999999987 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088423.365559IPR003851Zinc finger, Dof-type
PfamPF027011.1E-23556IPR003851Zinc finger, Dof-type
ProDomPD0074786.0E-17656IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 76 aa     Download sequence    Send to blast
ARTRRACPRC HSRETRFCYF NNYNVNQPRH YCKLCHQYWT AGGTLRKLRR NAGSRRCLFA  60
GVMQDSSSHE ECSGEV
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence (By similarity). Transcriptional repressor of 'CONSTANS' expression (By similarity). Regulates a photoperiodic flowering response. {ECO:0000250, ECO:0000269|PubMed:19619493}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Circadian-regulation. The transcript level rises progressively from dawn and decreases during the night. {ECO:0000269|PubMed:19619493}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020694660.12e-23cyclic dof factor 4-like
RefseqXP_026429024.12e-23cyclic dof factor 4-like
SwissprotO229679e-23CDF4_ARATH; Cyclic dof factor 4
TrEMBLA0A2I0X2Q14e-22A0A2I0X2Q1_9ASPA; Cyclic dof factor 4
STRINGXP_008813764.18e-22(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64952851
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G34140.14e-25Dof family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Bueso E, et al.
    Arabidopsis COGWHEEL1 links light perception and gibberellins with seed tolerance to deterioration.
    Plant J., 2016. 87(6): p. 583-96
    [PMID:27227784]