PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

PEQU_40061

Organism

Phalaenopsis equestris

Taxonomic ID

78828

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis

Family

ARR-B

Protein Properties

Length: 176aa MW: 20033.2 Da PI: 7.9239

Description

ARR-B family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PEQU_40061	genome	BGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	G2-like	77.8	1.3e-24	125	173	2	51
G2-like 2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51 +r+ WtpeLH++F++a++qL G+++A+Pk+il++m+ +gLt+e+v+SHLQ PEQU_40061 125 ARVSWTPELHAKFINALNQL-GIDRAVPKKILDIMDTPGLTRENVASHLQ 173 79****************.*************************** PP
2	Response_reg	58.9	2.8e-20	4	87	26	108
EEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTESEEEESS--HHHHH CS Response_reg 26 vaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGakdflsKpfdpeelv 108 v++ d++ +alell++++ +D++++D++m++mdG++ll+ e++lp+i+++ + + + + +k+Ga d+l+Kp+ eel+ PEQU_40061 4 VTVSDNALKALELLRANKggYDIVITDVNMSEMDGFKLLEIVV-IEMNLPVIMLSIDFDFQSVMKGIKYGAVDYLVKPVRLEELR 87 78889*******999999***************8665.5669********************************997 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
CDD	cd00156	2.29E-19	1	94	No hit	No description
PROSITE profile	PS50110	31.78	1	94	IPR001789	Signal transduction response regulator, receiver domain
Gene3D	G3DSA:3.40.50.2300	2.5E-27	2	113	No hit	No description
SuperFamily	SSF52172	6.55E-24	2	101	IPR011006	CheY-like superfamily
SMART	SM00448	0.0027	2	90	IPR001789	Signal transduction response regulator, receiver domain
Pfam	PF00072	2.7E-16	4	87	IPR001789	Signal transduction response regulator, receiver domain
PROSITE profile	PS51294	10.174	121	176	IPR017930	Myb domain
Gene3D	G3DSA:1.10.10.60	1.8E-23	122	173	IPR009057	Homeodomain-like
SuperFamily	SSF46689	1.79E-15	122	173	IPR009057	Homeodomain-like
TIGRFAMs	TIGR01557	6.0E-22	125	174	IPR006447	Myb domain, plants
Pfam	PF00249	4.3E-6	126	173	IPR001005	SANT/Myb domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0000160	Biological Process	phosphorelay signal transduction system
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 176 aa Download sequence Send to blast
NFPVTVSDNA LKALELLRAN KGGYDIVITD VNMSEMDGFK LLEIVVIEMN LPVIMLSIDF 60 DFQSVMKGIK YGAVDYLVKP VRLEELRLIW KHVARRSHHH EMKNANESKS KYKTESEDDF 120 SQKRARVSWT PELHAKFINA LNQLGIDRAV PKKILDIMDT PGLTRENVAS HLQVGS

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1irz_A	3e-18	121	173	2	54	ARR10-B
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional activator that binds specifically to the DNA sequence 5'-[AG]GATT-3'. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. Could directly activate some type-A response regulators in response to cytokinins. {ECO:0000269\|PubMed:11574878}.
UniProt	Transcriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250\|UniProtKB:Q940D0}.
UniProt	Transcriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250\|UniProtKB:Q940D0}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020578712.1	5e-69	two-component response regulator ORR23-like isoform X1
Refseq	XP_020578714.1	4e-69	two-component response regulator ARR18-like isoform X3
Swissprot	A2XE31	3e-54	ORR21_ORYSI; Two-component response regulator ORR21
Swissprot	O49397	7e-55	ARR10_ARATH; Two-component response regulator ARR10
Swissprot	Q8H7S7	3e-54	ORR21_ORYSJ; Two-component response regulator ORR21
TrEMBL	A0A2I0W9B1	4e-66	A0A2I0W9B1_9ASPA; Two-component response regulator ARR10
STRING	XP_010259817.1	2e-58	(Nelumbo nucifera)
STRING	GSMUA_Achr10P23650_001	7e-59	(Musa acuminata)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP5796	37	54

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G31920.1	3e-57	response regulator 10

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Hill K,Schaller GE Enhancing plant regeneration in tissue culture: a molecular approach through manipulation of cytokinin sensitivity. Plant Signal Behav, 2013. 8(10): p. doi: 10.4161/psb.25709 [PMID:23887495] Ramireddy E,Chang L,Schmülling T Cytokinin as a mediator for regulating root system architecture in response to environmental cues. Plant Signal Behav, 2014. 9(1): p. e27771 [PMID:24509549] Choi SH, et al. Gene duplication of type-B ARR transcription factors systematically extends transcriptional regulatory structures in Arabidopsis. Sci Rep, 2014. 4: p. 7197 [PMID:25425016] Cortleven A, et al. Cytokinin Regulates the Etioplast-Chloroplast Transition through the Two-Component Signaling System and Activation of Chloroplast-Related Genes. Plant Physiol., 2016. 172(1): p. 464-78 [PMID:27388681] Street IH, et al. Cytokinin acts through the auxin influx carrier AUX1 to regulate cell elongation in the root. Development, 2016. 143(21): p. 3982-3993 [PMID:27697901] Wang Y,Wu Y,Yu B,Yin Z,Xia Y EXTRA-LARGE G PROTEINs Interact with E3 Ligases PUB4 and PUB2 and Function in Cytokinin and Developmental Processes. Plant Physiol., 2017. 173(2): p. 1235-1246 [PMID:27986866] Zhang TQ, et al. A Two-Step Model for de Novo Activation of WUSCHEL during Plant Shoot Regeneration. Plant Cell, 2017. 29(5): p. 1073-1087 [PMID:28389585] Meng WJ, et al. Type-B ARABIDOPSIS RESPONSE REGULATORs Specify the Shoot Stem Cell Niche by Dual Regulation of WUSCHEL. Plant Cell, 2017. 29(6): p. 1357-1372 [PMID:28576846] Zubo YO, et al. Cytokinin induces genome-wide binding of the type-B response regulator ARR10 to regulate growth and development in Arabidopsis. Proc. Natl. Acad. Sci. U.S.A., 2017. 114(29): p. E5995-E6004 [PMID:28673986] Zhang F,May A,Irish VF Type-B ARABIDOPSIS RESPONSE REGULATORs Directly Activate WUSCHEL. Trends Plant Sci., 2017. 22(10): p. 815-817 [PMID:28886911] Rong XF, et al. Type-B ARRs Control Carpel Regeneration Through Mediating AGAMOUS Expression in Arabidopsis. Plant Cell Physiol., 2018. 59(4): p. 756-764 [PMID:29186581] Bustillo-Avendaño E, et al. Regulation of Hormonal Control, Cell Reprogramming, and Patterning during De Novo Root Organogenesis. Plant Physiol., 2018. 176(2): p. 1709-1727 [PMID:29233938]