![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | PEQU_40072 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
|
||||||||
| Family | GATA | ||||||||
| Protein Properties | Length: 100aa MW: 11189.8 Da PI: 10.9791 | ||||||||
| Description | GATA family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | GATA | 54.7 | 1.3e-17 | 29 | 63 | 1 | 35 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
Cs+C + Tp+WR gp g+ktLCnaCG+++++ +l
PEQU_40072 29 CSHCLSHRTPQWRAGPLGPKTLCNACGVRFKSGRL 63
*******************************9986 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00401 | 3.4E-14 | 23 | 73 | IPR000679 | Zinc finger, GATA-type |
| PROSITE profile | PS50114 | 11.002 | 23 | 59 | IPR000679 | Zinc finger, GATA-type |
| SuperFamily | SSF57716 | 2.95E-15 | 25 | 87 | No hit | No description |
| Gene3D | G3DSA:3.30.50.10 | 4.9E-14 | 27 | 64 | IPR013088 | Zinc finger, NHR/GATA-type |
| CDD | cd00202 | 2.06E-11 | 28 | 75 | No hit | No description |
| PROSITE pattern | PS00344 | 0 | 29 | 54 | IPR000679 | Zinc finger, GATA-type |
| Pfam | PF00320 | 1.9E-15 | 29 | 63 | IPR000679 | Zinc finger, GATA-type |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0008270 | Molecular Function | zinc ion binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 100 aa Download sequence Send to blast |
MEKLDKHQGK ANNGNGNGGE LHPLQPRRCS HCLSHRTPQW RAGPLGPKTL CNACGVRFKS 60 GRLHPEYRPA KSPTFVSYKH SNSHKKVMEM RMAVLSSNSK |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes. {ECO:0000269|PubMed:12139008}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020587604.1 | 2e-69 | GATA transcription factor 5-like | ||||
| Swissprot | O49741 | 2e-34 | GATA2_ARATH; GATA transcription factor 2 | ||||
| TrEMBL | A0A2I0VN21 | 1e-52 | A0A2I0VN21_9ASPA; GATA transcription factor 4 | ||||
| STRING | GSMUA_Achr2P12730_001 | 5e-46 | (Musa acuminata) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP5962 | 36 | 56 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G60530.1 | 7e-36 | GATA transcription factor 4 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




