![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | PEQU_40609 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
|
||||||||
| Family | bZIP | ||||||||
| Protein Properties | Length: 90aa MW: 9927.41 Da PI: 11.0501 | ||||||||
| Description | bZIP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | bZIP_1 | 55.2 | 1.6e-17 | 30 | 76 | 2 | 48 |
XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
bZIP_1 2 kelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkke 48
++l+r++r++kNRe+A rsR+RK++++ +Le+ v +Le+eN L ke
PEQU_40609 30 AALQRQKRMIKNRESAARSRERKQQYTNQLEQTVFKLEEENAILLKE 76
689***************************************99987 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PRINTS | PR00041 | 7.4E-5 | 28 | 44 | IPR001630 | cAMP response element binding (CREB) protein |
| SMART | SM00338 | 3.0E-9 | 29 | 87 | IPR004827 | Basic-leucine zipper domain |
| Pfam | PF00170 | 2.9E-15 | 30 | 76 | IPR004827 | Basic-leucine zipper domain |
| PROSITE profile | PS50217 | 10.484 | 31 | 76 | IPR004827 | Basic-leucine zipper domain |
| SuperFamily | SSF57959 | 2.81E-12 | 33 | 77 | No hit | No description |
| Gene3D | G3DSA:1.20.5.170 | 1.3E-15 | 34 | 78 | No hit | No description |
| PROSITE pattern | PS00036 | 0 | 36 | 51 | IPR004827 | Basic-leucine zipper domain |
| PRINTS | PR00041 | 7.4E-5 | 46 | 66 | IPR001630 | cAMP response element binding (CREB) protein |
| PRINTS | PR00041 | 7.4E-5 | 66 | 83 | IPR001630 | cAMP response element binding (CREB) protein |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 90 aa Download sequence Send to blast |
MAGMGDGAAA GGGERGKGRK RVAVDSADKA ALQRQKRMIK NRESAARSRE RKQQYTNQLE 60 QTVFKLEEEN AILLKERVPL SLSLSLSLVK |
| Nucleic Localization Signal ? help Back to Top | |||
|---|---|---|---|
| No. | Start | End | Sequence |
| 1 | 45 | 53 | ARSRERKQQ |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription activator that binds to the ABA-responsive elements (ABREs) in vitro. Involved in abiotic stress responses and abscisic acid (ABA) signaling (PubMed:20039193). Involved in the signaling pathway that induces growth inhibition in response to D-allose (PubMed:23397192). {ECO:0000269|PubMed:20039193, ECO:0000269|PubMed:23397192}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Induced by anoxia, drought, salt stress, oxidative stress, cold and abscisic acid (ABA) (PubMed:20039193). Induced by D-allose (PubMed:23397192). {ECO:0000269|PubMed:20039193, ECO:0000269|PubMed:23397192}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020587877.1 | 2e-46 | G-box-binding factor 4-like isoform X1 | ||||
| Refseq | XP_020587878.1 | 2e-46 | G-box-binding factor 4-like isoform X2 | ||||
| Swissprot | Q0JHF1 | 2e-20 | BZP12_ORYSJ; bZIP transcription factor 12 | ||||
| TrEMBL | A0A2I0WAD0 | 6e-27 | A0A2I0WAD0_9ASPA; G-box-binding factor 4 | ||||
| STRING | GSMUA_Achr3P22470_001 | 2e-20 | (Musa acuminata) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP2665 | 37 | 86 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G03970.1 | 1e-16 | G-box binding factor 4 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




