PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

PEQU_40665

Organism

Phalaenopsis equestris

Taxonomic ID

78828

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis

Family

NAC

Protein Properties

Length: 91aa MW: 10892.6 Da PI: 10.5331

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PEQU_40665	genome	BGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	111.9	6.8e-35	2	77	54	129
NAM 54 eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129 +ekew+fF+++d+ky+tg r+nrat+sgyWkatgkdke+++ kg vg+kktLvfy grap+g+k++Wvmheyrle PEQU_40665 2 GEKEWFFFCQKDRKYPTGMRTNRATESGYWKATGKDKEIYKGKGVIVGMKKTLVFYMGRAPRGQKSNWVMHEYRLE 77 579************************************9******************************85 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51005	36.539	1	91	IPR003441	NAC domain
SuperFamily	SSF101941	9.29E-36	2	86	IPR003441	NAC domain
Pfam	PF02365	1.1E-17	6	76	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 91 aa Download sequence Send to blast
MGEKEWFFFC QKDRKYPTGM RTNRATESGY WKATGKDKEI YKGKGVIVGM KKTLVFYMGR 60 APRGQKSNWV MHEYRLEGKH QEHVHLYKSR Q

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	7e-30	1	76	68	142	NO APICAL MERISTEM PROTEIN
1ut4_B	7e-30	1	76	68	142	NO APICAL MERISTEM PROTEIN
1ut7_A	7e-30	1	76	68	142	NO APICAL MERISTEM PROTEIN
1ut7_B	7e-30	1	76	68	142	NO APICAL MERISTEM PROTEIN
3swm_A	8e-30	1	76	71	145	NAC domain-containing protein 19
3swm_B	8e-30	1	76	71	145	NAC domain-containing protein 19
3swm_C	8e-30	1	76	71	145	NAC domain-containing protein 19
3swm_D	8e-30	1	76	71	145	NAC domain-containing protein 19
3swp_A	8e-30	1	76	71	145	NAC domain-containing protein 19
3swp_B	8e-30	1	76	71	145	NAC domain-containing protein 19
3swp_C	8e-30	1	76	71	145	NAC domain-containing protein 19
3swp_D	8e-30	1	76	71	145	NAC domain-containing protein 19
4dul_A	7e-30	1	76	68	142	NAC domain-containing protein 19
4dul_B	7e-30	1	76	68	142	NAC domain-containing protein 19
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Binds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269\|PubMed:27021284}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	JF831198	2e-78	JF831198.1 Dendrobium candidum NAC protein (NAC) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020578928.1	2e-63	NAC domain-containing protein 100-like
Swissprot	Q9FK44	7e-47	NAC87_ARATH; NAC domain-containing protein 87
TrEMBL	A0A2I0VQS3	1e-56	A0A2I0VQS3_9ASPA; NAC domain-containing protein 100
STRING	OB07G32150.1	1e-48	(Oryza brachyantha)
STRING	XP_010088484.1	2e-48	(Morus notabilis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP27555	3	5

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G18270.2	3e-49	Arabidopsis NAC domain containing protein 87

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444]