PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

PEQU_40965

Organism

Phalaenopsis equestris

Taxonomic ID

78828

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis

Family

bZIP

Protein Properties

Length: 86aa MW: 10177.6 Da PI: 9.7769

Description

bZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PEQU_40965	genome	BGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	27.6	6.3e-09	3	42	17	56
HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 17 ArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkev 56 A+rsR RK+++i+eLe+ v++L+ae ++ ele l ++ PEQU_40965 3 AQRSRVRKLQYIAELEKNVQALQAEQMEVSAELEFLDQQN 42 89*******************************9998875 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF57959	9.57E-7	3	45	No hit	No description
Gene3D	G3DSA:1.20.5.170	4.6E-9	3	45	No hit	No description

Sequence ? help Back to Top
Protein Sequence Length: 86 aa Download sequence Send to blast
QFAQRSRVRK LQYIAELEKN VQALQAEQME VSAELEFLDQ QNLILNLENK ALKQRLDSLA 60 QEHLVKCRNL NKLQRKEENS KQQNKS

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional activator involved in the sporophytic control of cell wall patterning and gametophytic control of pollen development. May play a role in the control of metabolic pathways regulating cellular transport and lipid metabolism. {ECO:0000269\|PubMed:17719007, ECO:0000269\|PubMed:19449183}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020575375.1	1e-37	uncharacterized protein At4g06598-like
Refseq	XP_020575376.1	1e-37	uncharacterized protein At4g06598-like
Swissprot	F4IN23	2e-17	BZP34_ARATH; Basic leucine zipper 34
TrEMBL	A0A3Q0I1L0	7e-34	A0A3Q0I1L0_PHODC; uncharacterized protein At4g06598-like isoform X4
STRING	XP_008786509.1	1e-33	(Phoenix dactylifera)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP3310	36	66

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G58110.2	6e-29	bZIP family protein

Publications ? help Back to Top
Jiang J,Zhang Z,Cao J Pollen wall development: the associated enzymes and metabolic pathways. Plant Biol (Stuttg), 2013. 15(2): p. 249-63 [PMID:23252839] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Gibalová A, et al. Characterization of pollen-expressed bZIP protein interactions and the role of ATbZIP18 in the male gametophyte. Plant Reprod, 2017. 30(1): p. 1-17 [PMID:27896439] Ezer D, et al. The G-Box Transcriptional Regulatory Code in Arabidopsis. Plant Physiol., 2017. 175(2): p. 628-640 [PMID:28864470]