PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

PEQU_41098

Organism

Phalaenopsis equestris

Taxonomic ID

78828

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis

Family

S1Fa-like

Protein Properties

Length: 53aa MW: 5888.07 Da PI: 9.9672

Description

S1Fa-like family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PEQU_41098	genome	BGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	S1FA	82.2	5.6e-26	9	53	4	48
S1FA 4 akveakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkk 48 +++e+kGlnP livllv+ +lll+f+vgny+lyvyaqk+lPP+kk PEQU_41098 9 VEEESKGLNPSLIVLLVIVTLLLLFFVGNYALYVYAQKTLPPKKK 53 68999***************************************8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
ProDom	PD019013	2.0E-4	7	48	No hit	No description
Pfam	PF04689	4.1E-23	10	53	IPR006779	DNA binding protein S1FA

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 53 aa Download sequence Send to blast
AKQGNNVIVE EESKGLNPSL IVLLVIVTLL LLFFVGNYAL YVYAQKTLPP KKK

Functional Description ? help Back to Top
Source	Description
UniProt	DNA-binding protein that specifically recognizes a negative element (S1F) within the RPS1 promoter. {ECO:0000250}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020597176.1	4e-27	DNA-binding protein S1FA
Swissprot	P42553	5e-19	S1FA1_ORYSJ; DNA-binding protein S1FA1
TrEMBL	J3LXK2	9e-17	J3LXK2_ORYBR; Uncharacterized protein
STRING	OB04G18770.1	2e-17	(Oryza brachyantha)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP5154	35	63