PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

PEQU_41557

Organism

Phalaenopsis equestris

Taxonomic ID

78828

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis

Family

MYB_related

Protein Properties

Length: 135aa MW: 14470.5 Da PI: 11.0776

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PEQU_41557	genome	BGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	25.6	2.9e-08	3	39	11	47
HHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 11 llvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 l++ + +++G+g+W++I+r + Rt+ q+ s+ qky PEQU_41557 3 LFLLGLEKFGKGDWRSISRNFVVSRTPTQVASHAQKY 39 688899******************************9 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	13.266	1	44	IPR017930	Myb domain
TIGRFAMs	TIGR01557	3.9E-12	2	42	IPR006447	Myb domain, plants
CDD	cd00167	4.87E-6	2	40	No hit	No description
SuperFamily	SSF46689	1.61E-10	2	45	IPR009057	Homeodomain-like
Gene3D	G3DSA:1.10.10.60	3.2E-6	3	38	IPR009057	Homeodomain-like
Pfam	PF00249	5.2E-6	3	39	IPR001005	SANT/Myb domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 135 aa Download sequence Send to blast
NRLFLLGLEK FGKGDWRSIS RNFVVSRTPT QVASHAQKYF IRLNSINRDR RRSSIHDITN 60 VNNGDVQTSS QGPITGQGIV NCAPPVGSFI NPPPLQPNVA AMGIYGAPVG HPVPGHIVSA 120 VGTPVMLPPG HAPYV

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator that binds to 5'-TATCCA-3' elements in gene promoters. Derepresses strongly the sugar-repressed transcription of promoters containing SRS or 5'-TATCCA-3' elements. Functions with GAMYB to integrate diverse nutrient starvation and gibberellin (GA) signaling pathways during germination of grains. Sugar, nitrogen and phosphate starvation signals converge and interconnect with GA to promote the co-nuclear import of MYBS1 and GAMYB, resulting in the expression of a large set of GA-inducible hydrolases, transporters, and regulators that are essential for mobilization of nutrient reserves in the endosperm to support seedling growth (PubMed:22773748). {ECO:0000269\|PubMed:12172034, ECO:0000269\|PubMed:22773748}.
UniProt	Transcription activator that binds to 5'-TATCCA-3' elements in gene promoters. Derepress strongly the sugar-repressed transcription of promoters containing SRS or 5'-TATCCA-3' elements. {ECO:0000250\|UniProtKB:Q8LH59}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Repressed by sucrose and gibberellic acid (GA). {ECO:0000269\|PubMed:12172034}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020597905.1	7e-94	transcription factor MYBS1-like
Swissprot	B8A9B2	2e-49	MYBS1_ORYSI; Transcription factor MYBS1
Swissprot	Q8LH59	2e-49	MYBS1_ORYSJ; Transcription factor MYBS1
TrEMBL	A0A2I0VP25	9e-76	A0A2I0VP25_9ASPA; Transcription factor DIVARICATA
STRING	GSMUA_Achr9P21870_001	5e-59	(Musa acuminata)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP9466	30	41

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G49010.1	2e-23	MYB family protein

Publications ? help Back to Top
Hong YF, et al. Convergent starvation signals and hormone crosstalk in regulating nutrient mobilization upon germination in cereals. Plant Cell, 2012. 24(7): p. 2857-73 [PMID:22773748]