![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | PGSC0003DMP400000548 | ||||||||
| Common Name | LOC102595015 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
|
||||||||
| Family | NF-YA | ||||||||
| Protein Properties | Length: 154aa MW: 17062.2 Da PI: 10.9578 | ||||||||
| Description | NF-YA family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | CBFB_NFYA | 104.7 | 8.4e-33 | 17 | 73 | 1 | 58 |
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58
d p+YVNaKQy++Il+RRq Rakle+++kl k+rkpylheSRh hA++R RgsgGrF
PGSC0003DMP400000548 17 DGPIYVNAKQYHGILRRRQIRAKLEAQNKL-VKNRKPYLHESRHLHAVNRVRGSGGRF 73
57****************************.**************************9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00521 | 1.1E-35 | 15 | 76 | IPR001289 | Nuclear transcription factor Y subunit A |
| PROSITE profile | PS51152 | 35.798 | 16 | 76 | IPR001289 | Nuclear transcription factor Y subunit A |
| Pfam | PF02045 | 3.4E-28 | 19 | 73 | IPR001289 | Nuclear transcription factor Y subunit A |
| PRINTS | PR00616 | 5.0E-24 | 19 | 41 | IPR001289 | Nuclear transcription factor Y subunit A |
| PROSITE pattern | PS00686 | 0 | 21 | 41 | IPR018362 | CCAAT-binding factor, conserved site |
| PRINTS | PR00616 | 5.0E-24 | 50 | 73 | IPR001289 | Nuclear transcription factor Y subunit A |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0016602 | Cellular Component | CCAAT-binding factor complex | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 154 aa Download sequence Send to blast |
MGIAPARVPL PIDMAEDGPI YVNAKQYHGI LRRRQIRAKL EAQNKLVKNR KPYLHESRHL 60 HAVNRVRGSG GRFLSSKKVH QSDPNSYPTN STSSLDSVEH EGSTSAFSSV RQDVVHNGIN 120 FQQQPDHMAF SVSSHMVITM QGNGSQQRAP VVR* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4awl_A | 1e-23 | 17 | 86 | 2 | 74 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters (By similarity). Involved in the blue light (BL) and abscisic acid (ABA) signaling pathways. {ECO:0000250, ECO:0000269|PubMed:17322342}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | PGSC0003DMP400000548 |
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | HG975451 | 1e-145 | HG975451.1 Solanum pennellii chromosome ch12, complete genome. | |||
| GenBank | HG975524 | 1e-145 | HG975524.1 Solanum lycopersicum chromosome ch12, complete genome. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_015166862.1 | 1e-109 | PREDICTED: nuclear transcription factor Y subunit A-7-like | ||||
| Refseq | XP_015166863.1 | 1e-109 | PREDICTED: nuclear transcription factor Y subunit A-7-like | ||||
| Refseq | XP_015166864.1 | 1e-109 | PREDICTED: nuclear transcription factor Y subunit A-7-like | ||||
| Refseq | XP_015166865.1 | 1e-109 | PREDICTED: nuclear transcription factor Y subunit A-7-like | ||||
| Swissprot | Q9SYH4 | 5e-36 | NFYA5_ARATH; Nuclear transcription factor Y subunit A-5 | ||||
| TrEMBL | M0ZH82 | 1e-107 | M0ZH82_SOLTU; Uncharacterized protein | ||||
| TrEMBL | M0ZH83 | 1e-108 | M0ZH83_SOLTU; Uncharacterized protein | ||||
| STRING | Solyc12g009050.1.1 | 1e-105 | (Solanum lycopersicum) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G54160.1 | 2e-38 | nuclear factor Y, subunit A5 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | PGSC0003DMP400000548 |
| Entrez Gene | 102595015 |




