![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | PGSC0003DMP400003166 | ||||||||
| Common Name | LOC102588755 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
|
||||||||
| Family | S1Fa-like | ||||||||
| Protein Properties | Length: 70aa MW: 7644.38 Da PI: 10.7983 | ||||||||
| Description | S1Fa-like family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | S1FA | 135.7 | 1.1e-42 | 3 | 69 | 4 | 70 |
S1FA 4 akveakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavPGe 70
+ ve+kG+nPGlivl+vvgglll+fl+gny+ly+yaqk+lPP+kkkPvskkk+k+e+lkqGv++PGe
PGSC0003DMP400003166 3 KDVEVKGFNPGLIVLIVVGGLLLTFLIGNYLLYMYAQKTLPPKKKKPVSKKKMKKERLKQGVSAPGE 69
579***************************************************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF04689 | 2.6E-41 | 5 | 69 | IPR006779 | DNA binding protein S1FA |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0016021 | Cellular Component | integral component of membrane | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 70 aa Download sequence Send to blast |
MAKDVEVKGF NPGLIVLIVV GGLLLTFLIG NYLLYMYAQK TLPPKKKKPV SKKKMKKERL 60 KQGVSAPGE* |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | DNA-binding protein that specifically recognizes a negative element (S1F) within the RPS1 promoter. {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | PGSC0003DMP400003166 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC232935 | 1e-104 | AC232935.1 Solanum lycopersicum chromosome 9 clone C09HBa0067J16, complete sequence. | |||
| GenBank | HG975521 | 1e-104 | HG975521.1 Solanum lycopersicum chromosome ch09, complete genome. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_006361797.1 | 3e-41 | PREDICTED: DNA-binding protein S1FA-like | ||||
| Swissprot | Q42337 | 2e-16 | S1FA2_ARATH; DNA-binding protein S1FA2 | ||||
| TrEMBL | M0ZNG1 | 6e-40 | M0ZNG1_SOLTU; Uncharacterized protein | ||||
| STRING | PGSC0003DMT400004441 | 1e-40 | (Solanum tuberosum) | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | PGSC0003DMP400003166 |
| Entrez Gene | 102588755 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




