PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

PGSC0003DMP400004972

Organism

Solanum tuberosum

Taxonomic ID

4113

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum

Family

TALE

Protein Properties

Length: 143aa MW: 16548.6 Da PI: 5.8633

Description

TALE family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PGSC0003DMP400004972	genome	PGSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Homeobox	30.5	6.2e-10	82	114	23	55
SS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS Homeobox 23 rypsaeereeLAkklgLterqVkvWFqNrRake 55 +yp++ee+ +L++ +gL+++q+ +WF N+R ++ PGSC0003DMP400004972 82 PYPTEEEKNRLSEMTGLDQKQINNWFINQRKRH 114 8*****************************985 PP
2	ELK	40.3	6.5e-14	34	55	1	22
ELK 1 ELKhqLlrKYsgyLgsLkqEFs 22 ELK++L+rKYsgyL+sL++EF+ PGSC0003DMP400004972 34 ELKEMLMRKYSGYLSSLRKEFL 55 9********************8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51213	11.383	34	54	IPR005539	ELK domain
Pfam	PF03789	6.9E-11	34	55	IPR005539	ELK domain
SMART	SM01188	3.1E-7	34	55	IPR005539	ELK domain
PROSITE profile	PS50071	12.698	54	117	IPR001356	Homeobox domain
SMART	SM00389	1.3E-12	56	121	IPR001356	Homeobox domain
SuperFamily	SSF46689	7.27E-20	56	126	IPR009057	Homeodomain-like
Gene3D	G3DSA:1.10.10.60	2.1E-27	59	119	IPR009057	Homeodomain-like
CDD	cd00086	2.80E-12	66	118	No hit	No description
Pfam	PF05920	2.2E-17	74	113	IPR008422	Homeobox KN domain
PROSITE pattern	PS00027	0	92	115	IPR017970	Homeobox, conserved site

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 143 aa Download sequence Send to blast
MSITDEAGGT SEEDLGCEEM EAADSPANRE GDNELKEMLM RKYSGYLSSL RKEFLKKRKK 60 GKLPKEARIV LLDWWNTHYR WPYPTEEEKN RLSEMTGLDQ KQINNWFINQ RKRHWRPSED 120 MKFALMEGVS AGSMYFDGSG GT*

Nucleic Localization Signal ? help Back to Top

No.	Start	End	Sequence
1	49	58	LRKEFLKKRK
2	55	59	KKRKK

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor that may be involved in shoot formation during embryogenesis. {ECO:0000269\|PubMed:10080693}.
UniProt	Probable transcription factor that may be involved in shoot formation during embryogenesis. {ECO:0000269\|PubMed:10080693, ECO:0000269\|PubMed:10488233}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	PGSC0003DMP400004972

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	KJ477691	0.0	KJ477691.1 Solanum tuberosum class I knox protein (KN1) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_001275325.1	1e-100	homeobox protein knotted-1-like 1-like
Swissprot	A2Y007	5e-53	KNOSA_ORYSI; Homeobox protein knotted-1-like 10
Swissprot	Q7GDL5	5e-53	KNOSA_ORYSJ; Homeobox protein knotted-1-like 10
TrEMBL	M0ZSK2	1e-99	M0ZSK2_SOLTU; Uncharacterized protein
TrEMBL	M0ZSK4	1e-101	M0ZSK4_SOLTU; Uncharacterized protein
STRING	PGSC0003DMT400007159	1e-100	(Solanum tuberosum)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G62360.1	2e-36	KNOX/ELK homeobox transcription factor

Link Out ? help Back to Top
Phytozome	PGSC0003DMP400004972

Publications ? help Back to Top
Ito Y,Eiguchi M,Kurata N KNOX homeobox genes are sufficient in maintaining cultured cells in an undifferentiated state in rice. Genesis, 2001. 30(4): p. 231-8 [PMID:11536429] Postma-Haarsma AD, et al. Developmental regulation and downstream effects of the knox class homeobox genes Oskn2 and Oskn3 from rice. Plant Mol. Biol., 2002. 48(4): p. 423-41 [PMID:11908517] Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Kuijt SJ, et al. Different subcellular localization and trafficking properties of KNOX class 1 homeodomain proteins from rice. Plant Mol. Biol., 2004. 55(6): p. 781-96 [PMID:15604716] Cheng CH, et al. A fine physical map of the rice chromosome 5. Mol. Genet. Genomics, 2005. 274(4): p. 337-45 [PMID:16261349] Xu X, et al. Genome sequence and analysis of the tuber crop potato. Nature, 2011. 475(7355): p. 189-95 [PMID:21743474] Chu H, et al. A CLE-WOX signalling module regulates root meristem maintenance and vascular tissue development in rice. J. Exp. Bot., 2013. 64(17): p. 5359-69 [PMID:24043854] Kuijt SJ, et al. Interaction between the GROWTH-REGULATING FACTOR and KNOTTED1-LIKE HOMEOBOX families of transcription factors. Plant Physiol., 2014. 164(4): p. 1952-66 [PMID:24532604] Coudert Y, et al. Identification of CROWN ROOTLESS1-regulated genes in rice reveals specific and conserved elements of postembryonic root formation. New Phytol., 2015. 206(1): p. 243-54 [PMID:25442012] Xu Y, et al. OsARID3, an AT-rich Interaction Domain-containing protein, is required for shoot meristem development in rice. Plant J., 2015. 83(5): p. 806-17 [PMID:26121094] Kir G, et al. RNA Interference Knockdown of BRASSINOSTEROID INSENSITIVE1 in Maize Reveals Novel Functions for Brassinosteroid Signaling in Controlling Plant Architecture. Plant Physiol., 2015. 169(1): p. 826-39 [PMID:26162429]