PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

PGSC0003DMP400006021

Organism

Solanum tuberosum

Taxonomic ID

4113

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum

Family

TCP

Protein Properties

Length: 158aa MW: 18036.5 Da PI: 10.2041

Description

TCP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PGSC0003DMP400006021	genome	PGSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	TCP	92.3	1e-28	71	137	3	69
TCP 3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssss 69 +++++ ski T++g+RdRR+Rls+ a++fFdLq+ LGfdk+skti+WL++ ++ a elt+ s+ + PGSC0003DMP400006021 71 KRERSCSKILTAQGPRDRRIRLSIAMARKFFDLQELLGFDKPSKTIDWLFTHSQVALEELTNWSTHQ 137 577888*******************************************************985554 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51369	28.101	71	130	IPR017887	Transcription factor TCP subgroup
Pfam	PF03634	1.3E-27	77	136	IPR005333	Transcription factor, TCP

Sequence ? help Back to Top
Protein Sequence Length: 158 aa Download sequence Send to blast
MFSASNSSTH DNPLPQYISS SFHTSSPFVG LNGNQILLHQ YYQNQFSSHY LAKNNCVDSL 60 RSFPMKKKPK KRERSCSKIL TAQGPRDRRI RLSIAMARKF FDLQELLGFD KPSKTIDWLF 120 THSQVALEEL TNWSTHQTQI SGLILALTII KYQNEPS*

Functional Description ? help Back to Top
Source	Description
UniProt	Involved in the dorsovental asymmetry of flowers. Retards growth rate and reduces organ number in the dorsal region of flowers. Binds specifically to the DNA sequence 5'-GGNCCCNC-3', and is able to bind to the RAD promoter sequence in vivo. {ECO:0000269\|PubMed:16236768, ECO:0000269\|PubMed:8893002}.
UniProt	Involved in the dorsovental asymmetry of flowers. Retards growth rate and reduces organ number in the dorsal region of flowers (By similarity). {ECO:0000250}.
UniProt	Involved in the dorsovental asymmetry of flowers. Retards growth rate and reduces organ number in the dorsal region of flowers (By similarity). {ECO:0000250}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	PGSC0003DMP400006021

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	HG975442	1e-168	HG975442.1 Solanum pennellii chromosome ch03, complete genome.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_015069311.1	3e-83	transcription factor CYCLOIDEA-like
Swissprot	O49250	8e-30	CYCLD_ANTMA; Transcription factor CYCLOIDEA
Swissprot	Q9SBV6	5e-30	CYCLD_ANTLN; Transcription factor CYCLOIDEA (Fragment)
Swissprot	Q9SBV9	5e-30	CYCLD_ANTMH; Transcription factor CYCLOIDEA (Fragment)
TrEMBL	M0ZUX3	1e-113	M0ZUX3_SOLTU; Uncharacterized protein
STRING	PGSC0003DMT400008673	1e-114	(Solanum tuberosum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA4333	22	44

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G68800.1	9e-24	TCP domain protein 12

Link Out ? help Back to Top
Phytozome	PGSC0003DMP400006021

Publications ? help Back to Top
Vieira CP,Vieira J,Charlesworth D Evolution of the cycloidea gene family in Antirrhinum and Misopates. Mol. Biol. Evol., 1999. 16(11): p. 1474-83 [PMID:10555278] Gubitz T,Caldwell A,Hudson A Rapid molecular evolution of CYCLOIDEA-like genes in Antirrhinum and its relatives. Mol. Biol. Evol., 2003. 20(9): p. 1537-44 [PMID:12832647] Reeves PA,Olmstead RG Evolution of the TCP gene family in Asteridae: cladistic and network approaches to understanding regulatory gene family diversification and its impact on morphological evolution. Mol. Biol. Evol., 2003. 20(12): p. 1997-2009 [PMID:12885953] Costa MM,Fox S,Hanna AI,Baxter C,Coen E Evolution of regulatory interactions controlling floral asymmetry. Development, 2005. 132(22): p. 5093-101 [PMID:16236768] Xu X, et al. Genome sequence and analysis of the tuber crop potato. Nature, 2011. 475(7355): p. 189-95 [PMID:21743474] Luo D,Carpenter R,Vincent C,Copsey L,Coen E Origin of floral asymmetry in Antirrhinum. Nature, 1996. 383(6603): p. 794-9 [PMID:8893002]