![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | PGSC0003DMP400006327 | ||||||||
| Common Name | LOC102603672 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
|
||||||||
| Family | GATA | ||||||||
| Protein Properties | Length: 128aa MW: 13994.1 Da PI: 10.8234 | ||||||||
| Description | GATA family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | GATA | 60.3 | 2.5e-19 | 48 | 82 | 1 | 35 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
Cs+Cg+ kTp+WR gp g ktLCnaCG+++++ +l
PGSC0003DMP400006327 48 CSHCGVQKTPQWRAGPMGAKTLCNACGVRFKSGRL 82
*******************************9986 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50114 | 11.78 | 42 | 78 | IPR000679 | Zinc finger, GATA-type |
| SMART | SM00401 | 3.7E-16 | 42 | 96 | IPR000679 | Zinc finger, GATA-type |
| SuperFamily | SSF57716 | 2.28E-15 | 43 | 106 | No hit | No description |
| Gene3D | G3DSA:3.30.50.10 | 1.4E-15 | 46 | 80 | IPR013088 | Zinc finger, NHR/GATA-type |
| CDD | cd00202 | 1.00E-12 | 47 | 95 | No hit | No description |
| Pfam | PF00320 | 3.1E-17 | 48 | 82 | IPR000679 | Zinc finger, GATA-type |
| PROSITE pattern | PS00344 | 0 | 48 | 73 | IPR000679 | Zinc finger, GATA-type |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0008270 | Molecular Function | zinc ion binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 128 aa Download sequence Send to blast |
MSSSPTASWF LYPTPVHSAE SPGKPLAKKL KKKPAPHGGN GPQQPRRCSH CGVQKTPQWR 60 AGPMGAKTLC NACGVRFKSG RLLPEYRPAC SPTFSTELHS NNHRKVLEMR RKKESEETGL 120 AQPVQSF* |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes (By similarity). {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | PGSC0003DMP400006327 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | HG975441 | 1e-152 | HG975441.1 Solanum pennellii chromosome ch02, complete genome. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_006340696.1 | 7e-90 | PREDICTED: GATA transcription factor 5-like | ||||
| Swissprot | Q9FH57 | 9e-48 | GATA5_ARATH; GATA transcription factor 5 | ||||
| TrEMBL | M0ZVM0 | 2e-88 | M0ZVM0_SOLTU; GATA transcription factor | ||||
| STRING | PGSC0003DMT400009118 | 3e-89 | (Solanum tuberosum) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G66320.2 | 9e-48 | GATA transcription factor 5 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | PGSC0003DMP400006327 |
| Entrez Gene | 102603672 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




