![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | PGSC0003DMP400007650 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 159aa MW: 16680.4 Da PI: 5.0739 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 187 | 1.4e-58 | 21 | 116 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkky 90
reqdrflPianvsrimkk+lPanakiskdaketvqecvsefisf+t+easdkcqrekrktingddllwa++tlGfe+yveplk+yl+ky
PGSC0003DMP400007650 21 REQDRFLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTINGDDLLWAMTTLGFEEYVEPLKIYLAKY 109
89*************************************************************************************** PP
NF-YB 91 relegek 97
re+egek
PGSC0003DMP400007650 110 REMEGEK 116
*****97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 3.1E-56 | 15 | 127 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 3.11E-41 | 23 | 125 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 3.5E-28 | 26 | 90 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 2.2E-21 | 54 | 72 | No hit | No description |
| PROSITE pattern | PS00685 | 0 | 57 | 73 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
| PRINTS | PR00615 | 2.2E-21 | 73 | 91 | No hit | No description |
| PRINTS | PR00615 | 2.2E-21 | 92 | 110 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 159 aa Download sequence Send to blast |
MADSDNESGG HNNANSEGST REQDRFLPIA NVSRIMKKAL PANAKISKDA KETVQECVSE 60 FISFITGEAS DKCQREKRKT INGDDLLWAM TTLGFEEYVE PLKIYLAKYR EMEGEKTTMG 120 RTGEKDGGGG DMAGGGGGVS SGGGYNGGGG GGSGQGRR* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5g49_A | 7e-50 | 16 | 111 | 2 | 97 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | PGSC0003DMP400007650 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC209585 | 0.0 | AC209585.1 Solanum lycopersicum DNA sequence from clone LE_HBa-26C13 on chromosome 12, complete sequence. | |||
| GenBank | HG975524 | 0.0 | HG975524.1 Solanum lycopersicum chromosome ch12, complete genome. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_015166197.1 | 1e-107 | PREDICTED: nuclear transcription factor Y subunit B-3 | ||||
| Swissprot | O23310 | 2e-75 | NFYB3_ARATH; Nuclear transcription factor Y subunit B-3 | ||||
| TrEMBL | M0ZYV7 | 1e-105 | M0ZYV7_SOLTU; Uncharacterized protein | ||||
| STRING | PGSC0003DMT400010977 | 1e-106 | (Solanum tuberosum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA111 | 24 | 356 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G14540.1 | 1e-76 | nuclear factor Y, subunit B3 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | PGSC0003DMP400007650 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




