PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

PGSC0003DMP400008051

Organism

Solanum tuberosum

Taxonomic ID

4113

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum

Family

G2-like

Protein Properties

Length: 119aa MW: 13070.9 Da PI: 9.0223

Description

G2-like family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PGSC0003DMP400008051	genome	PGSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	G2-like	111.4	4.5e-35	49	103	1	55
G2-like 1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 +prlrWt eLHerFv+av+qLGG++kAtPkti+++m+vkgLtl+h+kSHLQkYRl PGSC0003DMP400008051 49 RPRLRWTAELHERFVDAVTQLGGPDKATPKTIMKAMGVKGLTLYHLKSHLQKYRL 103 59****************************************************8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	2.2E-33	46	104	IPR009057	Homeodomain-like
PROSITE profile	PS51294	13.03	46	106	IPR017930	Myb domain
SuperFamily	SSF46689	5.2E-18	48	104	IPR009057	Homeodomain-like
TIGRFAMs	TIGR01557	9.6E-25	50	104	IPR006447	Myb domain, plants
Pfam	PF00249	4.1E-10	51	102	IPR001005	SANT/Myb domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 119 aa Download sequence Send to blast
MYSSLGIDGN GGVNEYHHHH HLHSLQSSLS GEMTNLAGDA CLVLTADHRP RLRWTAELHE 60 RFVDAVTQLG GPDKATPKTI MKAMGVKGLT LYHLKSHLQK YRLGKQPKEA AESYKDGI*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
6j4r_A	4e-21	49	105	1	57	Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B	4e-21	49	105	1	57	Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C	4e-21	49	105	1	57	Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D	4e-21	49	105	1	57	Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional activator (PubMed:26586833). Acts redundantly with PHR1 as a key component of the central regulatory system controlling transcriptional responses to Pi starvation (PubMed:26586833). Binds in a sequence-specific manner to phosphate starvation-regulated promoters (PubMed:26586833). {ECO:0000269\|PubMed:26586833}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	PGSC0003DMP400008051

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Up-regulated in roots by low Pi. {ECO:0000269\|PubMed:26586833}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	HG975451	1e-105	HG975451.1 Solanum pennellii chromosome ch12, complete genome.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_006349927.1	1e-81	PREDICTED: myb family transcription factor APL-like isoform X1
Refseq	XP_006349928.1	1e-81	PREDICTED: myb family transcription factor APL-like isoform X2
Swissprot	Q94A57	2e-44	PHL2_ARATH; Protein PHR1-LIKE 2
TrEMBL	M0ZZT4	4e-82	M0ZZT4_SOLTU; Uncharacterized protein
TrEMBL	M0ZZT5	3e-80	M0ZZT5_SOLTU; Uncharacterized protein
STRING	PGSC0003DMT400011598	4e-81	(Solanum tuberosum)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G24120.1	2e-46	G2-like family protein

Link Out ? help Back to Top
Phytozome	PGSC0003DMP400008051

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Xu X, et al. Genome sequence and analysis of the tuber crop potato. Nature, 2011. 475(7355): p. 189-95 [PMID:21743474]