![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | PGSC0003DMP400013018 | ||||||||
| Common Name | LOC102600754 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
|
||||||||
| Family | NF-YA | ||||||||
| Protein Properties | Length: 136aa MW: 15261.8 Da PI: 10.7715 | ||||||||
| Description | NF-YA family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | CBFB_NFYA | 96.8 | 2.3e-30 | 3 | 59 | 1 | 58 |
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58
+ep+YVNaKQy+rIl+RRq+Rak+e ekk +k+rkpylheSRh+hAlrR R+sgGrF
PGSC0003DMP400013018 3 QEPVYVNAKQYRRILQRRQSRAKAELEKKQ-IKGRKPYLHESRHQHALRRVRASGGRF 59
69************************9999.**************************9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00521 | 2.0E-31 | 1 | 62 | IPR001289 | Nuclear transcription factor Y subunit A |
| PROSITE profile | PS51152 | 34.175 | 2 | 62 | IPR001289 | Nuclear transcription factor Y subunit A |
| Pfam | PF02045 | 3.1E-25 | 4 | 59 | IPR001289 | Nuclear transcription factor Y subunit A |
| PRINTS | PR00616 | 3.8E-23 | 5 | 27 | IPR001289 | Nuclear transcription factor Y subunit A |
| PRINTS | PR00616 | 3.8E-23 | 36 | 59 | IPR001289 | Nuclear transcription factor Y subunit A |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0010262 | Biological Process | somatic embryogenesis | ||||
| GO:0048510 | Biological Process | regulation of timing of transition from vegetative to reproductive phase | ||||
| GO:0055046 | Biological Process | microgametogenesis | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 136 aa Download sequence Send to blast |
MAQEPVYVNA KQYRRILQRR QSRAKAELEK KQIKGRKPYL HESRHQHALR RVRASGGRFA 60 KKTDASKGTG SVSSSGSEPL QFNAADIQKR HENGRLAELQ QSYSNGSSYG NQSTFQESKD 120 EYQSAESREG VFSGK* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4awl_A | 3e-18 | 3 | 59 | 2 | 58 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA |
| Search in ModeBase | ||||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | PGSC0003DMP400013018 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | BT014146 | 0.0 | BT014146.1 Lycopersicon esculentum clone 133265F, mRNA sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_006361756.1 | 4e-92 | PREDICTED: nuclear transcription factor Y subunit A-1 | ||||
| Refseq | XP_006361757.1 | 4e-92 | PREDICTED: nuclear transcription factor Y subunit A-1 | ||||
| TrEMBL | M1ABF2 | 9e-91 | M1ABF2_SOLTU; Uncharacterized protein | ||||
| TrEMBL | M1ABF3 | 2e-92 | M1ABF3_SOLTU; Uncharacterized protein | ||||
| STRING | PGSC0003DMT400018959 | 2e-91 | (Solanum tuberosum) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G20910.1 | 9e-32 | nuclear factor Y, subunit A9 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | PGSC0003DMP400013018 |
| Entrez Gene | 102600754 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




