![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | PGSC0003DMP400014333 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
|
||||||||
| Family | NF-YA | ||||||||
| Protein Properties | Length: 89aa MW: 10119.7 Da PI: 11.086 | ||||||||
| Description | NF-YA family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | CBFB_NFYA | 48.3 | 3.3e-15 | 31 | 65 | 1 | 36 |
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrk 36
+ep+YVNaKQy++Il+RRq Rak+ ++k+ ksrk
PGSC0003DMP400014333 31 EEPMYVNAKQYHGILRRRQLRAKAVLQQKV-VKSRK 65
69****************************.88887 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00521 | 8.6E-9 | 29 | 88 | IPR001289 | Nuclear transcription factor Y subunit A |
| PROSITE profile | PS51152 | 15.622 | 30 | 88 | IPR001289 | Nuclear transcription factor Y subunit A |
| Pfam | PF02045 | 1.4E-11 | 32 | 65 | IPR001289 | Nuclear transcription factor Y subunit A |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 89 aa Download sequence Send to blast |
MAPSSIVNQN MERSSAVHHN GRMILPVEVK EEPMYVNAKQ YHGILRRRQL RAKAVLQQKV 60 VKSRKFESKV MKHTDIHDPK AGSNWANS* |
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | PGSC0003DMP400014333 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC215487 | 3e-89 | AC215487.4 Solanum lycopersicum cultivar Heinz 1706 chromosome 0 clone C00SLm0076E07, complete sequence. | |||
| GenBank | AC244298 | 3e-89 | AC244298.9 Solanum lycopersicum strain Heinz 1706 chromosome 10 clone hba-22l14 map 10, complete sequence. | |||
| GenBank | AC244588 | 3e-89 | AC244588.6 Solanum lycopersicum strain Heinz 1706 chromosome 10 clone hba-44j8 map 10, complete sequence. | |||
| GenBank | HG975522 | 3e-89 | HG975522.1 Solanum lycopersicum chromosome ch10, complete genome. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_015165892.1 | 5e-34 | PREDICTED: nuclear transcription factor Y subunit A-7-like | ||||
| TrEMBL | M1AEI4 | 2e-58 | M1AEI4_SOLTU; Uncharacterized protein | ||||
| STRING | PGSC0003DMT400021053 | 1e-33 | (Solanum tuberosum) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G20910.1 | 6e-15 | nuclear factor Y, subunit A9 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | PGSC0003DMP400014333 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




