PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

PGSC0003DMP400015396

Organism

Solanum tuberosum

Taxonomic ID

4113

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum

Family

MYB_related

Protein Properties

Length: 73aa MW: 8442.42 Da PI: 5.4807

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PGSC0003DMP400015396	genome	PGSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	31.8	3.4e-10	26	57	1	32
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmg 32 rg+WT eEd l ++++ +G g+W++ ar+ g PGSC0003DMP400015396 26 RGPWTVEEDFTLMNYIAHHGEGRWNSLARCAG 57 89***************************998 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF46689	2.15E-9	21	57	IPR009057	Homeodomain-like
PROSITE profile	PS51294	9.297	21	72	IPR017930	Myb domain
Gene3D	G3DSA:1.10.10.60	8.3E-11	24	57	IPR009057	Homeodomain-like
Pfam	PF00249	5.4E-8	26	57	IPR001005	SANT/Myb domain
CDD	cd00167	7.11E-6	28	58	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0009651	Biological Process	response to salt stress
GO:0009737	Biological Process	response to abscisic acid
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 73 aa Download sequence Send to blast
MDHQHVKAGL SRVDANKNED DMDLRRGPWT VEEDFTLMNY IAHHGEGRWN SLARCAGNSF 60 YTYVFYLCDI FL*

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor contributing to the regulation of stamen maturation and male fertility in response to jasmonate signaling. Required for correct timing of anther dehiscence. Acts as a negative regulator of abscisic acid-induced cell death. Not involved in the regulation of BOI. Regulated by MYB21 and at a lower level by MYB24. Negatively regulated by the proteasome in an SCF(COI1) E3 ubiquitin-protein ligase complex-dependent manner. {ECO:0000269\|PubMed:14555693, ECO:0000269\|PubMed:19091873, ECO:0000269\|PubMed:20921156, ECO:0000269\|PubMed:23952703}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	PGSC0003DMP400015396

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Up-regulated by jasmonate and pathogen infection. {ECO:0000269\|PubMed:14555693, ECO:0000269\|PubMed:19091873}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AC246582	3e-86	AC246582.4 Solanum lycopersicum strain Heinz 1706 chromosome 1 clone slm-26i13 map 1, complete sequence.
GenBank	AC246642	3e-86	AC246642.3 Solanum lycopersicum strain Heinz 1706 chromosome 1 clone slm-41f18 map 1, complete sequence.
GenBank	HG975513	3e-86	HG975513.1 Solanum lycopersicum chromosome ch01, complete genome.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_006337993.1	2e-35	PREDICTED: transcription factor MYB108-like
Swissprot	Q9LDE1	2e-17	MY108_ARATH; Transcription factor MYB108
TrEMBL	M1AGY2	4e-48	M1AGY2_SOLTU; Uncharacterized protein
STRING	PGSC0003DMT400022600	9e-35	(Solanum tuberosum)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G06490.1	8e-20	myb domain protein 108

Link Out ? help Back to Top
Phytozome	PGSC0003DMP400015396

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Xu X, et al. Genome sequence and analysis of the tuber crop potato. Nature, 2011. 475(7355): p. 189-95 [PMID:21743474] Cheng HQ, et al. The cotton MYB108 forms a positive feedback regulation loop with CML11 and participates in the defense response against Verticillium dahliae infection. J. Exp. Bot., 2016. 67(6): p. 1935-50 [PMID:26873979] Sanz-Fernández M, et al. Screening Arabidopsis mutants in genes useful for phytoremediation. J. Hazard. Mater., 2017. 335: p. 143-151 [PMID:28441590] Chou ML, et al. The Direct Involvement of Dark-Induced Tic55 Protein in Chlorophyll Catabolism and Its Indirect Role in the MYB108-NAC Signaling Pathway during Leaf Senescence in Arabidopsis thaliana. Int J Mol Sci, 2018. [PMID:29937503]