PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

PGSC0003DMP400023930

Organism

Solanum tuberosum

Taxonomic ID

4113

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum

Family

NF-YB

Protein Properties

Length: 67aa MW: 7528.78 Da PI: 7.4109

Description

NF-YB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PGSC0003DMP400023930	genome	PGSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NF-YB	54.4	3.1e-17	16	66	2	54
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkc 54 +eqdrf+P +v+ri +++lP +akis+d+k t++ec+s fi ++t+ea+ +c PGSC0003DMP400023930 16 EEQDRFMP--DVGRITHRTLPPHAKISDDTKRTMHECISVFICLITCEANARC 66 69**99..8*************************************999 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.20.10	7.9E-14	14	66	IPR009072	Histone-fold
SuperFamily	SSF47113	7.33E-8	18	66	IPR009072	Histone-fold
Pfam	PF00808	1.9E-6	25	66	IPR003958	Transcription factor CBF/NF-Y/archaeal histone domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0046982	Molecular Function	protein heterodimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 67 aa Download sequence Send to blast
MKYAHLNQAV VGCIIEEQDR FMPDVGRITH RTLPPHAKIS DDTKRTMHEC ISVFICLITC 60 EANARC*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5g49_A	2e-16	15	66	6	59	NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. Plays a role in the regulation of the embryogenesis. Involved in the abscisic acid (ABA) signaling pathway. {ECO:0000269\|PubMed:12509518, ECO:0000269\|PubMed:17322342}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	PGSC0003DMP400023930

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_006356441.2	5e-27	PREDICTED: nuclear transcription factor Y subunit B-4-like
Refseq	XP_015168329.1	5e-27	PREDICTED: nuclear transcription factor Y subunit B-4-like
Refseq	XP_015168330.1	5e-27	PREDICTED: nuclear transcription factor Y subunit B-4-like
Refseq	XP_015168331.1	5e-27	PREDICTED: nuclear transcription factor Y subunit B-4-like
Swissprot	Q84W66	4e-17	NFYB6_ARATH; Nuclear transcription factor Y subunit B-6
TrEMBL	M1B1Z1	3e-42	M1B1Z1_SOLTU; Uncharacterized protein
STRING	PGSC0003DMT400035193	5e-43	(Solanum tuberosum)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G47670.1	2e-19	nuclear factor Y, subunit B6

Link Out ? help Back to Top
Phytozome	PGSC0003DMP400023930

Publications ? help Back to Top
Xu X, et al. Genome sequence and analysis of the tuber crop potato. Nature, 2011. 475(7355): p. 189-95 [PMID:21743474] Jia H,McCarty DR,Suzuki M Distinct roles of LAFL network genes in promoting the embryonic seedling fate in the absence of VAL repression. Plant Physiol., 2013. 163(3): p. 1293-305 [PMID:24043445] Kim HU, et al. Ectopic overexpression of castor bean LEAFY COTYLEDON2 (LEC2) in Arabidopsis triggers the expression of genes that encode regulators of seed maturation and oil body proteins in vegetative tissues. FEBS Open Bio, 2013. 4: p. 25-32 [PMID:24363987] Gnesutta N,Saad D,Chaves-Sanjuan A,Mantovani R,Nardini M Crystal Structure of the Arabidopsis thaliana L1L/NF-YC3 Histone-fold Dimer Reveals Specificities of the LEC1 Family of NF-Y Subunits in Plants. Mol Plant, 2017. 10(4): p. 645-648 [PMID:27871811] Li D, et al. MYB89 Transcription Factor Represses Seed Oil Accumulation. Plant Physiol., 2017. 173(2): p. 1211-1225 [PMID:27932421] Zhao H, et al. The Arabidopsis thaliana Nuclear Factor Y Transcription Factors. Front Plant Sci, 2016. 7: p. 2045 [PMID:28119722] Han JD, et al. Evolutionary Analysis of the LAFL Genes Involved in the Land Plant Seed Maturation Program. Front Plant Sci, 2017. 8: p. 439 [PMID:28421087]