PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

PGSC0003DMP400026672

Common Name

LOC102588157

Organism

Solanum tuberosum

Taxonomic ID

4113

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum

Family

MIKC_MADS

Protein Properties

Length: 187aa MW: 21565.8 Da PI: 10.2342

Description

MIKC_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PGSC0003DMP400026672	genome	PGSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	91.3	4.9e-29	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien++nrqvtfskRrng+lKKA+ELS+LCdaeva+++fs++gk y ++s PGSC0003DMP400026672 9 KRIENQTNRQVTFSKRRNGLLKKAYELSILCDAEVALLLFSPSGKAYNFAS 59 79**********************************************986 PP
2	K-box	57.9	4.4e-20	81	157	9	85
K-box 9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkek 85 + + +e ++++++ + + i++L+ +hl Ge+L+sL +keL+qLe+qL ++++iRskK+++l+e+ +lqk+ + PGSC0003DMP400026672 81 QGLRAMEVWRTKIDDMTRTIHELEARDKHLAGEELSSLGMKELKQLERQLRIGVERIRSKKHKILHEENIHLQKQVR 157 55667899***************9*********************************************9876 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	2.1E-40	1	60	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	32.646	1	61	IPR002100	Transcription factor, MADS-box
CDD	cd00265	8.94E-39	2	78	No hit	No description
SuperFamily	SSF55455	2.49E-31	2	78	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	5.0E-31	3	23	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	7.3E-27	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	5.0E-31	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	5.0E-31	38	59	IPR002100	Transcription factor, MADS-box
Pfam	PF01486	1.4E-15	85	159	IPR002487	Transcription factor, K-box
PROSITE profile	PS51297	10.51	86	186	IPR002487	Transcription factor, K-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 187 aa Download sequence Send to blast
MGRGKVELKR IENQTNRQVT FSKRRNGLLK KAYELSILCD AEVALLLFSP SGKAYNFASH 60 DIERTILRYK NEVGLSKNSD QGLRAMEVWR TKIDDMTRTI HELEARDKHL AGEELSSLGM 120 KELKQLERQL RIGVERIRSK KHKILHEENI HLQKQVRLSE IEGSSRILDS EASELLSKGR 180 RIIYDL*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1tqe_P	2e-23	1	69	1	69	Myocyte-specific enhancer factor 2B
1tqe_Q	2e-23	1	69	1	69	Myocyte-specific enhancer factor 2B
1tqe_R	2e-23	1	69	1	69	Myocyte-specific enhancer factor 2B
1tqe_S	2e-23	1	69	1	69	Myocyte-specific enhancer factor 2B
6c9l_A	2e-23	1	69	1	69	Myocyte-specific enhancer factor 2B
6c9l_B	2e-23	1	69	1	69	Myocyte-specific enhancer factor 2B
6c9l_C	2e-23	1	69	1	69	Myocyte-specific enhancer factor 2B
6c9l_D	2e-23	1	69	1	69	Myocyte-specific enhancer factor 2B
6c9l_E	2e-23	1	69	1	69	Myocyte-specific enhancer factor 2B
6c9l_F	2e-23	1	69	1	69	Myocyte-specific enhancer factor 2B
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor involved in seed development. {ECO:0000269\|PubMed:29853599}.
UniProt	Probable transcription factor involved in seed development (PubMed:21447172, Ref.1, PubMed:29853599). Plays a role in seed morphogenesis by promoting the correct development of endotesta cell layer, which directs the further development of the seed coat, the endosperm, and consequently the embryo (Ref.1, PubMed:29853599). {ECO:0000269\|PubMed:21447172, ECO:0000269\|PubMed:29853599, ECO:0000269\|Ref.1}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	PGSC0003DMP400026672

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	X60760	0.0	X60760.1 L.esculentum TDR8 mRNA.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_015166004.1	1e-132	PREDICTED: truncated transcription factor CAULIFLOWER A-like isoform X2
Swissprot	A0A217EJJ0	3e-48	AG11S_VITVI; Agamous-like MADS-box protein AGL11
Swissprot	F6I457	4e-48	AG11C_VITVI; Agamous-like MADS-box protein AGL11
TrEMBL	M1B838	1e-130	M1B838_SOLTU; Uncharacterized protein
STRING	PGSC0003DMT400039313	1e-127	(Solanum tuberosum)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G42830.2	5e-49	MIKC_MADS family protein

Link Out ? help Back to Top
Phytozome	PGSC0003DMP400026672
Entrez Gene	102588157

Publications ? help Back to Top
Jaillon O, et al. The grapevine genome sequence suggests ancestral hexaploidization in major angiosperm phyla. Nature, 2007. 449(7161): p. 463-7 [PMID:17721507] Díaz-Riquelme J,Lijavetzky D,Martínez-Zapater JM,Carmona MJ Genome-wide analysis of MIKCC-type MADS box genes in grapevine. Plant Physiol., 2009. 149(1): p. 354-69 [PMID:18997115] Mejía N, et al. Molecular, genetic and transcriptional evidence for a role of VvAGL11 in stenospermocarpic seedlessness in grapevine. BMC Plant Biol., 2011. 11: p. 57 [PMID:21447172] Xu X, et al. Genome sequence and analysis of the tuber crop potato. Nature, 2011. 475(7355): p. 189-95 [PMID:21743474] Grimplet J,Martínez-Zapater JM,Carmona MJ Structural and functional annotation of the MADS-box transcription factor family in grapevine. BMC Genomics, 2016. 17: p. 80 [PMID:26818751] Malabarba J, et al. The MADS-box gene Agamous-like 11 is essential for seed morphogenesis in grapevine. J. Exp. Bot., 2017. 68(7): p. 1493-1506 [PMID:28369525] Royo C, et al. The Major Origin of Seedless Grapes Is Associated with a Missense Mutation in the MADS-Box Gene VviAGL11. Plant Physiol., 2018. 177(3): p. 1234-1253 [PMID:29853599]