PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400031036
Organism
Solanum tuberosum
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family M-type_MADS
Protein Properties Length: 109aa    MW: 12405.6 Da    PI: 11.0564
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400031036genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF85.33.5e-273484151
                          S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                          krie+ksnrq +f+kR +g++KKA+E S+LCd++vav+i+s++g+l+e+ss
  PGSC0003DMP400031036 34 KRIESKSNRQMSFCKRSKGLMKKAKEFSILCDVDVAVVIISNRGRLHEFSS 84
                          79***********************************************96 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554552.22E-252686IPR002100Transcription factor, MADS-box
PROSITE profilePS5006627.9922686IPR002100Transcription factor, MADS-box
SMARTSM004321.1E-302685IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-232848IPR002100Transcription factor, MADS-box
PfamPF003198.6E-233582IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-234863IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-236384IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 109 aa     Download sequence    Send to blast
MVTGRSNGDE NFWEIIIRLG LRKNRMGRRK LEIKRIESKS NRQMSFCKRS KGLMKKAKEF  60
SILCDVDVAV VIISNRGRLH EFSSTNSLYV SRYGALFPDL PTIPTVVV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P7e-162686161Myocyte-specific enhancer factor 2B
1tqe_Q7e-162686161Myocyte-specific enhancer factor 2B
1tqe_R7e-162686161Myocyte-specific enhancer factor 2B
1tqe_S7e-162686161Myocyte-specific enhancer factor 2B
6c9l_A7e-162686161Myocyte-specific enhancer factor 2B
6c9l_B7e-162686161Myocyte-specific enhancer factor 2B
6c9l_C7e-162686161Myocyte-specific enhancer factor 2B
6c9l_D7e-162686161Myocyte-specific enhancer factor 2B
6c9l_E7e-162686161Myocyte-specific enhancer factor 2B
6c9l_F7e-162686161Myocyte-specific enhancer factor 2B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor active in inflorescence development and floral organogenesis. Functions with SEPALLATA1/AGL2 and SEPALLATA2/AGL4 to ensure proper development of petals, stamens and carpels and to prevent the indeterminate growth of the flower meristem. Interacts with APETALA1, AGAMOUS or APETALA3/PISTILLATA to form complexes, that could be involved in genes regulation during floral meristem development (PubMed:10821278, PubMed:11206550). Binds specifically to the CArG box DNA sequence 5'-CC (A/T)6 GG-3' (PubMed:16080001). {ECO:0000269|PubMed:10821278, ECO:0000269|PubMed:11206550, ECO:0000269|PubMed:16080001}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400031036
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754511e-33HG975451.1 Solanum pennellii chromosome ch12, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006360256.14e-58PREDICTED: truncated transcription factor CAULIFLOWER A-like
SwissprotO224568e-22SEP3_ARATH; Developmental protein SEPALLATA 3
TrEMBLM1BI795e-73M1BI79_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000457978e-74(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4024625
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G09960.32e-24MIKC_MADS family protein
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]
  2. Maejima K, et al.
    Recognition of floral homeotic MADS domain transcription factors by a phytoplasmal effector, phyllogen, induces phyllody.
    Plant J., 2014. 78(4): p. 541-54
    [PMID:24597566]
  3. MacLean AM, et al.
    Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner.
    PLoS Biol., 2014. 12(4): p. e1001835
    [PMID:24714165]
  4. Iglesias FM, et al.
    The arabidopsis DNA polymerase δ has a role in the deposition of transcriptionally active epigenetic marks, development and flowering.
    PLoS Genet., 2015. 11(2): p. e1004975
    [PMID:25693187]
  5. He Q,Fu AY,Zhang GC,Li TJ,Zhang JH
    Arabidopsis thaliana SEPALLATA3 protein prokaryotic expression and purification.
    Cell. Mol. Biol. (Noisy-le-grand), 2015. 61(2): p. 60-3
    [PMID:26025404]
  6. Maejima K, et al.
    Degradation of class E MADS-domain transcription factors in Arabidopsis by a phytoplasmal effector, phyllogen.
    Plant Signal Behav, 2015. 10(8): p. e1042635
    [PMID:26179462]
  7. Muiño JM, et al.
    Evolution of DNA-Binding Sites of a Floral Master Regulatory Transcription Factor.
    Mol. Biol. Evol., 2016. 33(1): p. 185-200
    [PMID:26429922]
  8. Shi Q,Zhou J,Wang P,Lin X,Xu Y
    Protein expression and characterization of SEP3 from Arabidopsis thaliana.
    Genet. Mol. Res., 2015. 14(4): p. 12529-36
    [PMID:26505403]
  9. He Q,Fu AY,Zhang GC,Li TJ,Zhang JH
    Cloning, Prokaryotic Expression and Purification of CpfS1 Gene from Arabidopsis Thaliana.
    Cell. Mol. Biol. (Noisy-le-grand), 2015. 61(8): p. 123-7
    [PMID:26718440]
  10. Soza VL,Snelson CD,Hewett Hazelton KD,Di Stilio VS
    Partial redundancy and functional specialization of E-class SEPALLATA genes in an early-diverging eudicot.
    Dev. Biol., 2016. 419(1): p. 143-155
    [PMID:27502434]
  11. Conn VM, et al.
    A circRNA from SEPALLATA3 regulates splicing of its cognate mRNA through R-loop formation.
    Nat Plants, 2017. 3: p. 17053
    [PMID:28418376]
  12. Käppel S,Melzer R,Rümpler F,Gafert C,Theißen G
    The floral homeotic protein SEPALLATA3 recognizes target DNA sequences by shape readout involving a conserved arginine residue in the MADS-domain.
    Plant J., 2018. 95(2): p. 341-357
    [PMID:29744943]