PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

PGSC0003DMP400033524

Organism

Solanum tuberosum

Taxonomic ID

4113

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum

Family

NAC

Protein Properties

Length: 162aa MW: 18452.3 Da PI: 10.0005

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PGSC0003DMP400033524	genome	PGSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	170.5	5.4e-53	14	139	1	128
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkd 89 lppGfrF Ptdeel+v+yL++kv+g++++l ++i+e+d+yk++Pw Lp+k+ +ekewyfFs+rd+ky++g+r+nr++ sgyWkatg+d PGSC0003DMP400033524 14 LPPGFRFYPTDEELLVQYLCRKVAGHDFSL-QIIAEIDLYKFDPWVLPSKAIFGEKEWYFFSPRDRKYPNGSRPNRVAGSGYWKATGTD 101 79*************************9.89***********7777799******************************** PP NAM 90 kevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 k +++ +g++vg+kk Lvfy g+apkg+kt+W+mheyrl PGSC0003DMP400033524 102 KIITT-EGRKVGIKKALVFYIGKAPKGTKTNWIMHEYRL 139 9999.999***************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	5.1E-61	8	146	IPR003441	NAC domain
PROSITE profile	PS51005	54.417	14	154	IPR003441	NAC domain
Pfam	PF02365	4.2E-27	15	139	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0009414	Biological Process	response to water deprivation
GO:0009737	Biological Process	response to abscisic acid
GO:0045893	Biological Process	positive regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 162 aa Download sequence Send to blast
MGVQEMDPLT QLSLPPGFRF YPTDEELLVQ YLCRKVAGHD FSLQIIAEID LYKFDPWVLP 60 SKAIFGEKEW YFFSPRDRKY PNGSRPNRVA GSGYWKATGT DKIITTEGRK VGIKKALVFY 120 IGKAPKGTKT NWIMHEYRLS EPTTKSGSSR VYTLSPHNLK I*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	1e-100	1	151	4	154	NO APICAL MERISTEM PROTEIN
1ut4_B	1e-100	1	151	4	154	NO APICAL MERISTEM PROTEIN
1ut7_A	1e-100	1	151	4	154	NO APICAL MERISTEM PROTEIN
1ut7_B	1e-100	1	151	4	154	NO APICAL MERISTEM PROTEIN
3swm_A	1e-100	1	151	7	157	NAC domain-containing protein 19
3swm_B	1e-100	1	151	7	157	NAC domain-containing protein 19
3swm_C	1e-100	1	151	7	157	NAC domain-containing protein 19
3swm_D	1e-100	1	151	7	157	NAC domain-containing protein 19
3swp_A	1e-100	1	151	7	157	NAC domain-containing protein 19
3swp_B	1e-100	1	151	7	157	NAC domain-containing protein 19
3swp_C	1e-100	1	151	7	157	NAC domain-containing protein 19
3swp_D	1e-100	1	151	7	157	NAC domain-containing protein 19
4dul_A	1e-100	1	151	4	154	NAC domain-containing protein 19
4dul_B	1e-100	1	151	4	154	NAC domain-containing protein 19
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that acts downstream of MYC2 in the jasmonate-mediated response to Botrytis cinerea infection (PubMed:28733419). With MYC2 forms a transcription module that regulates wounding-responsive genes (PubMed:28733419). Involved in jasmonate- and coronatine-mediated stomatal reopening in response to Pseudomonas syringae pv tomato DC3000 infection (PubMed:25005917). Regulates the expression of threonine deaminase 2 (TD2) through promoter binding (PubMed:28733419). {ECO:0000269\|PubMed:25005917, ECO:0000269\|PubMed:28733419}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	PGSC0003DMP400033524

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by jasmonate (JA) (PubMed:25005917, PubMed:28733419, PubMed:30610166). Induced by wounding (PubMed:28733419, PubMed:25005917). Induced by infection with the fungal pathogen Botrytis cinerea (PubMed:28733419). Induced by coronatine (PubMed:25005917). {ECO:0000269\|PubMed:25005917, ECO:0000269\|PubMed:28733419, ECO:0000269\|PubMed:30610166}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	HG975446	1e-120	HG975446.1 Solanum pennellii chromosome ch07, complete genome.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_015081066.1	1e-108	NAC domain-containing protein 72-like
Swissprot	A0A3Q7HH64	1e-108	JA2L_SOLLC; NAC domain-containing protein JA2L
TrEMBL	M1BP50	1e-116	M1BP50_SOLTU; Uncharacterized protein
STRING	PGSC0003DMT400049665	1e-108	(Solanum tuberosum)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G15500.1	1e-102	NAC domain containing protein 3

Link Out ? help Back to Top
Phytozome	PGSC0003DMP400033524

Publications ? help Back to Top
Xu X, et al. Genome sequence and analysis of the tuber crop potato. Nature, 2011. 475(7355): p. 189-95 [PMID:21743474] Tomato Genome Consortium The tomato genome sequence provides insights into fleshy fruit evolution. Nature, 2012. 485(7400): p. 635-41 [PMID:22660326] Du M, et al. MYC2 Orchestrates a Hierarchical Transcriptional Cascade That Regulates Jasmonate-Mediated Plant Immunity in Tomato. Plant Cell, 2017. 29(8): p. 1883-1906 [PMID:28733419] Liu Y, et al. MYC2 Regulates the Termination of Jasmonate Signaling via an Autoregulatory Negative Feedback Loop. Plant Cell, 2019. 31(1): p. 106-127 [PMID:30610166]