![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | PGSC0003DMP400033616 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
|
||||||||
| Family | HSF | ||||||||
| Protein Properties | Length: 107aa MW: 12032.5 Da PI: 6.5044 | ||||||||
| Description | HSF family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | HSF_DNA-bind | 78.7 | 9.2e-25 | 39 | 99 | 2 | 62 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHTTE CS
HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmYgF 62
Fl+k+ye+++d+++++++sw++ g+sfvv+d++ f++++Lp++Fkh+nf+SFvRQ n+Y +
PGSC0003DMP400033616 39 FLTKTYEMVDDSTIDHVVSWNRGGQSFVVWDPHAFSTTLLPRFFKHNNFSSFVRQQNTYYW 99
9**********************************************************87 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.10 | 6.9E-27 | 33 | 100 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| SuperFamily | SSF46785 | 4.9E-23 | 35 | 100 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| SMART | SM00415 | 3.2E-21 | 35 | 106 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| Pfam | PF00447 | 1.3E-20 | 39 | 99 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 4.8E-14 | 39 | 62 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 4.8E-14 | 77 | 89 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 4.8E-14 | 90 | 102 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 107 aa Download sequence Send to blast |
MNQLYSVKEE FPGSSSGGKP PPPTPQPMEG LHDIGPPPFL TKTYEMVDDS TIDHVVSWNR 60 GGQSFVVWDP HAFSTTLLPR FFKHNNFSSF VRQQNTYYWT ICGLPN* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5d8k_B | 2e-15 | 37 | 97 | 3 | 63 | Heat shock factor protein 2 |
| 5d8l_B | 2e-15 | 37 | 97 | 3 | 63 | Heat shock factor protein 2 |
| 5d8l_D | 2e-15 | 37 | 97 | 3 | 63 | Heat shock factor protein 2 |
| 5d8l_F | 2e-15 | 37 | 97 | 3 | 63 | Heat shock factor protein 2 |
| 5d8l_H | 2e-15 | 37 | 97 | 3 | 63 | Heat shock factor protein 2 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional activator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE). | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | PGSC0003DMP400033616 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | HG975521 | 6e-88 | HG975521.1 Solanum lycopersicum chromosome ch09, complete genome. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_015165187.1 | 5e-66 | PREDICTED: heat stress transcription factor A-7a-like | ||||
| Swissprot | Q9M1V5 | 9e-37 | HFA7B_ARATH; Heat stress transcription factor A-7b | ||||
| TrEMBL | M1BPC5 | 2e-73 | M1BPC5_SOLTU; Uncharacterized protein | ||||
| STRING | PGSC0003DMT400049803 | 3e-74 | (Solanum tuberosum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA572 | 24 | 113 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G51910.1 | 4e-37 | heat shock transcription factor A7A | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | PGSC0003DMP400033616 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




