PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

PGSC0003DMP400033928

Organism

Solanum tuberosum

Taxonomic ID

4113

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum

Family

NAC

Protein Properties

Length: 180aa MW: 20944.2 Da PI: 9.931

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PGSC0003DMP400033928	genome	PGSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	176.8	6.1e-55	20	146	1	129
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkd 89 lppGfrFhPtdeel+++yL kkv + ++++ +i +vd++k+ePw+Lp k+k +ekewyfF+ rdkky+tg r+nrat++gyWkatgkd PGSC0003DMP400033928 20 LPPGFRFHPTDEELITHYLSKKVVDMNFSA-IAIGDVDMNKIEPWELPWKAKIGEKEWYFFCVRDKKYPTGLRTNRATAAGYWKATGKD 107 79***********************999.88***********98999******************************** PP NAM 90 kevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129 ke+++ +++lvg+kktLvfykgrap+gekt+Wv heyrle PGSC0003DMP400033928 108 KEIFR-GRSLVGMKKTLVFYKGRAPRGEKTNWVTHEYRLE 146 *.999***************************85 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	2.48E-58	9	152	IPR003441	NAC domain
PROSITE profile	PS51005	52.815	20	171	IPR003441	NAC domain
Pfam	PF02365	2.1E-28	21	145	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 180 aa Download sequence Send to blast
MENFSGTVKM DDQQQQQMEL PPGFRFHPTD EELITHYLSK KVVDMNFSAI AIGDVDMNKI 60 EPWELPWKAK IGEKEWYFFC VRDKKYPTGL RTNRATAAGY WKATGKDKEI FRGRSLVGMK 120 KTLVFYKGRA PRGEKTNWVT HEYRLEGRLS LNNLPKTVKV QTLCINPLFY PLFDFKIPN*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	2e-51	17	145	14	142	NO APICAL MERISTEM PROTEIN
1ut4_B	2e-51	17	145	14	142	NO APICAL MERISTEM PROTEIN
1ut7_A	2e-51	17	145	14	142	NO APICAL MERISTEM PROTEIN
1ut7_B	2e-51	17	145	14	142	NO APICAL MERISTEM PROTEIN
3swm_A	3e-51	17	145	17	145	NAC domain-containing protein 19
3swm_B	3e-51	17	145	17	145	NAC domain-containing protein 19
3swm_C	3e-51	17	145	17	145	NAC domain-containing protein 19
3swm_D	3e-51	17	145	17	145	NAC domain-containing protein 19
3swp_A	3e-51	17	145	17	145	NAC domain-containing protein 19
3swp_B	3e-51	17	145	17	145	NAC domain-containing protein 19
3swp_C	3e-51	17	145	17	145	NAC domain-containing protein 19
3swp_D	3e-51	17	145	17	145	NAC domain-containing protein 19
4dul_A	2e-51	17	145	14	142	NAC domain-containing protein 19
4dul_B	2e-51	17	145	14	142	NAC domain-containing protein 19
Search in ModeBase

Cis-element ? help Back to Top
Source	Link
PlantRegMap	PGSC0003DMP400033928

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Repressed post-transcriptionally by miR164. {ECO:0000269\|PubMed:15294871, ECO:0000269\|PubMed:17098808, ECO:0000269\|PubMed:18305205, ECO:0000305\|PubMed:15723790}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	HG975442	1e-157	HG975442.1 Solanum pennellii chromosome ch03, complete genome.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_006364584.1	1e-115	PREDICTED: NAC domain-containing protein 100
Swissprot	Q9FLR3	1e-90	NAC79_ARATH; NAC domain-containing protein 79
TrEMBL	M1BQ13	1e-132	M1BQ13_SOLTU; Uncharacterized protein
STRING	PGSC0003DMT400050262	1e-115	(Solanum tuberosum)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G07680.1	4e-93	NAC domain containing protein 80

Link Out ? help Back to Top
Phytozome	PGSC0003DMP400033928

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Xu X, et al. Genome sequence and analysis of the tuber crop potato. Nature, 2011. 475(7355): p. 189-95 [PMID:21743474] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Vidal EA,Álvarez JM,Gutiérrez RA Nitrate regulation of AFB3 and NAC4 gene expression in Arabidopsis roots depends on NRT1.1 nitrate transport function. Plant Signal Behav, 2014. 9(3): p. e28501 [PMID:24642706] Lee MH,Jeon HS,Kim HG,Park OK An Arabidopsis NAC transcription factor NAC4 promotes pathogen-induced cell death under negative regulation by microRNA164. New Phytol., 2017. 214(1): p. 343-360 [PMID:28032643]