![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | PGSC0003DMP400036612 | ||||||||
| Common Name | LOC102600275 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
|
||||||||
| Family | NF-YA | ||||||||
| Protein Properties | Length: 118aa MW: 13053.8 Da PI: 10.4299 | ||||||||
| Description | NF-YA family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | CBFB_NFYA | 105.4 | 5e-33 | 22 | 78 | 1 | 58 |
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58
dep++VNaKQy++Il+RRq+Rak+++ekkl k+rkpylheSRh hAl+R+Rg+gGrF
PGSC0003DMP400036612 22 DEPVFVNAKQYHGILRRRQSRAKADSEKKL-LKARKPYLHESRHLHALKRARGCGGRF 78
79****************************.**************************9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00521 | 1.9E-35 | 20 | 81 | IPR001289 | Nuclear transcription factor Y subunit A |
| PROSITE profile | PS51152 | 36.134 | 21 | 81 | IPR001289 | Nuclear transcription factor Y subunit A |
| Pfam | PF02045 | 1.5E-27 | 23 | 78 | IPR001289 | Nuclear transcription factor Y subunit A |
| PRINTS | PR00616 | 4.8E-23 | 24 | 46 | IPR001289 | Nuclear transcription factor Y subunit A |
| PRINTS | PR00616 | 4.8E-23 | 55 | 78 | IPR001289 | Nuclear transcription factor Y subunit A |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 118 aa Download sequence Send to blast |
MVHVQLMGIQ QAGVPLPSDA IDEPVFVNAK QYHGILRRRQ SRAKADSEKK LLKARKPYLH 60 ESRHLHALKR ARGCGGRFLT AKETDNQQKQ DESGDKSHVN INLESGKDKV ASSENAS* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4awl_A | 2e-24 | 21 | 91 | 1 | 71 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | PGSC0003DMP400036612 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | BT013370 | 0.0 | BT013370.1 Lycopersicon esculentum clone 135390R, mRNA sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_006353014.1 | 5e-82 | PREDICTED: nuclear transcription factor Y subunit A-7 isoform X1 | ||||
| Refseq | XP_006353015.1 | 5e-82 | PREDICTED: nuclear transcription factor Y subunit A-7 isoform X2 | ||||
| Swissprot | Q84JP1 | 1e-49 | NFYA7_ARATH; Nuclear transcription factor Y subunit A-7 | ||||
| TrEMBL | M1BWA7 | 1e-80 | M1BWA7_SOLTU; Uncharacterized protein | ||||
| TrEMBL | M1BWA8 | 5e-81 | M1BWA8_SOLTU; Uncharacterized protein | ||||
| STRING | PGSC0003DMT400054416 | 2e-81 | (Solanum tuberosum) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G30500.2 | 6e-52 | nuclear factor Y, subunit A7 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | PGSC0003DMP400036612 |
| Entrez Gene | 102600275 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




