![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | PGSC0003DMP400038596 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 174aa MW: 19498.2 Da PI: 9.5985 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 94.9 | 7.2e-30 | 1 | 85 | 10 | 94 |
NF-YB 10 ianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrele 94
+anv+rim+ +lP+naki + +ke+vq+ s +i +t++a ++c++e+rkt++++d+lwa+ ++G+ +++ l +yl++yre +
PGSC0003DMP400038596 1 MANVTRIMRGILPTNAKINDGSKESVQKLGSYYINRITKKAKERCNKEQRKTVTAEDILWAMNKMGLTNHAGLLAQYLNRYREYN 85
79********************************************************************************986 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF47113 | 1.84E-23 | 1 | 86 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 9.4E-17 | 1 | 62 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| Gene3D | G3DSA:1.10.20.10 | 2.6E-28 | 2 | 86 | IPR009072 | Histone-fold |
| PRINTS | PR00615 | 1.1E-5 | 26 | 44 | No hit | No description |
| PRINTS | PR00615 | 1.1E-5 | 45 | 63 | No hit | No description |
| PRINTS | PR00615 | 1.1E-5 | 64 | 82 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0009738 | Biological Process | abscisic acid-activated signaling pathway | ||||
| GO:0009785 | Biological Process | blue light signaling pathway | ||||
| GO:0010262 | Biological Process | somatic embryogenesis | ||||
| GO:0045723 | Biological Process | positive regulation of fatty acid biosynthetic process | ||||
| GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 174 aa Download sequence Send to blast |
MANVTRIMRG ILPTNAKIND GSKESVQKLG SYYINRITKK AKERCNKEQR KTVTAEDILW 60 AMNKMGLTNH AGLLAQYLNR YREYNQVSYF NVRKPNCELT FASLAAPHPI LPIEPIPGYP 120 YPYFPPNVLF YDPVTAALVT SRDFEMAVGN DGSPSESSSS TVAPAYPFGQ WRQ* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5g49_A | 3e-29 | 1 | 83 | 15 | 97 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. Plays a role in the regulation of the embryogenesis. Involved in the abscisic acid (ABA) signaling pathway. {ECO:0000269|PubMed:12509518, ECO:0000269|PubMed:17322342}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | PGSC0003DMP400038596 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | HG975446 | 1e-132 | HG975446.1 Solanum pennellii chromosome ch07, complete genome. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_006346131.1 | 1e-128 | PREDICTED: nuclear transcription factor Y subunit B-9-like | ||||
| Swissprot | Q84W66 | 5e-27 | NFYB6_ARATH; Nuclear transcription factor Y subunit B-6 | ||||
| TrEMBL | M1C0X7 | 1e-127 | M1C0X7_SOLTU; Uncharacterized protein | ||||
| STRING | PGSC0003DMT400057379 | 1e-127 | (Solanum tuberosum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA14746 | 5 | 10 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G47670.2 | 6e-30 | nuclear factor Y, subunit B6 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | PGSC0003DMP400038596 |




