![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | PGSC0003DMP400039576 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
|
||||||||
| Family | SBP | ||||||||
| Protein Properties | Length: 116aa MW: 13179.7 Da PI: 5.67 | ||||||||
| Description | SBP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SBP | 77.7 | 1.8e-24 | 51 | 102 | 2 | 53 |
-SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETT CS
SBP 2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhels 53
Cqve+C+ad+ +ak+yh rhkvCe+h+kap+vl++gl+qrfCqqCsr +l+
PGSC0003DMP400039576 51 CQVEDCTADMVNAKTYHCRHKVCEFHAKAPAVLIDGLRQRFCQQCSRQEALT 102
***********************************************88775 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:4.10.1100.10 | 1.4E-24 | 44 | 102 | IPR004333 | Transcription factor, SBP-box |
| PROSITE profile | PS51141 | 18.99 | 48 | 115 | IPR004333 | Transcription factor, SBP-box |
| SuperFamily | SSF103612 | 3.4E-23 | 49 | 102 | IPR004333 | Transcription factor, SBP-box |
| Pfam | PF03110 | 1.5E-19 | 51 | 102 | IPR004333 | Transcription factor, SBP-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0009908 | Biological Process | flower development | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0046872 | Molecular Function | metal ion binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 116 aa Download sequence Send to blast |
MENSKWEGKR NMEEEDDEED ENAVEDTKRK RVLTRSGRKV SMGEGSRQPS CQVEDCTADM 60 VNAKTYHCRH KVCEFHAKAP AVLIDGLRQR FCQQCSRQEA LTADSPRVPA EIDHI* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1ul4_A | 4e-18 | 51 | 97 | 11 | 57 | squamosa promoter binding protein-like 4 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcriptional factor. Binds to the promoter of the SQUAMOSA gene. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | PGSC0003DMP400039576 |
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | HG975449 | 1e-135 | HG975449.1 Solanum pennellii chromosome ch10, complete genome. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_006361029.1 | 2e-67 | PREDICTED: squamosa promoter-binding protein 1-like | ||||
| Swissprot | Q38741 | 4e-33 | SBP1_ANTMA; Squamosa promoter-binding protein 1 | ||||
| TrEMBL | M1C388 | 1e-80 | M1C388_SOLTU; Uncharacterized protein | ||||
| STRING | PGSC0003DMT400058753 | 9e-67 | (Solanum tuberosum) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G33810.1 | 2e-24 | squamosa promoter binding protein-like 3 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | PGSC0003DMP400039576 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




