![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | PGSC0003DMP400039765 | ||||||||
| Common Name | LOC102577630, WHY2 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
|
||||||||
| Family | Whirly | ||||||||
| Protein Properties | Length: 111aa MW: 12274.8 Da PI: 7.7037 | ||||||||
| Description | Whirly family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Whirly | 101.2 | 1e-31 | 1 | 72 | 68 | 139 |
Whirly 68 laskesceffhdpaakgsneGkvrkalkvePlpdGsGlfvnlsvtnslvkgnesfsvPvskaefavlrsllv 139
+++++s+effhdp++ +sn+G+vrk+l+++P +dGsG+f++lsv n+ +k+n++f+vPv+ aefav+r++++
PGSC0003DMP400039765 1 MGTRDSSEFFHDPSMLSSNAGQVRKSLSIKPNADGSGYFISLSVVNNNLKTNDRFTVPVTTAEFAVMRTAFS 72
89*******************************************************************995 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF54447 | 2.51E-31 | 1 | 108 | IPR009044 | ssDNA-binding transcriptional regulator |
| Gene3D | G3DSA:2.30.31.10 | 2.5E-35 | 1 | 91 | IPR009044 | ssDNA-binding transcriptional regulator |
| Pfam | PF08536 | 3.2E-26 | 1 | 70 | IPR013742 | Plant transcription factor |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006281 | Biological Process | DNA repair | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005739 | Cellular Component | mitochondrion | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 111 aa Download sequence Send to blast |
MGTRDSSEFF HDPSMLSSNA GQVRKSLSIK PNADGSGYFI SLSVVNNNLK TNDRFTVPVT 60 TAEFAVMRTA FSFALPHIMG WDRFTNRPSE SISQSPSKVV PQLMEAEWDR * |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 3n1h_A | 3e-60 | 1 | 90 | 83 | 172 | StWhy2 |
| 3n1i_A | 3e-60 | 1 | 90 | 83 | 172 | protein StWhy2 |
| 3n1j_A | 3e-60 | 1 | 90 | 83 | 172 | Protein StWhy2 |
| 3n1k_A | 3e-60 | 1 | 90 | 83 | 172 | protein StWhy2 |
| 3n1l_A | 3e-60 | 1 | 90 | 83 | 172 | protein StWhy2 |
| 3r9y_A | 3e-60 | 1 | 90 | 83 | 172 | Why2 protein |
| 3r9z_A | 3e-60 | 1 | 90 | 83 | 172 | Why2 protein |
| 3ra0_A | 3e-60 | 1 | 90 | 83 | 172 | Why2 protein |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Single-stranded DNA-binding protein that may be involved in the maintenance of mitochondrial genome stability by preventing break-induced DNA rearrangements. {ECO:0000269|PubMed:21911368}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | PGSC0003DMP400039765 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | HM234504 | 0.0 | HM234504.1 Solanum tuberosum Why2 protein mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_015166241.1 | 2e-75 | PREDICTED: single-stranded DNA-bindig protein WHY2, mitochondrial isoform X1 | ||||
| Swissprot | D9J034 | 2e-76 | WHY2_SOLTU; Single-stranded DNA-binding protein WHY2, mitochondrial | ||||
| TrEMBL | A0A3Q7JMC9 | 1e-73 | A0A3Q7JMC9_SOLLC; Uncharacterized protein | ||||
| TrEMBL | M1C3P3 | 1e-75 | M1C3P3_SOLTU; Uncharacterized protein | ||||
| STRING | Solyc11g044750.1.1 | 1e-74 | (Solanum lycopersicum) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G71260.1 | 2e-51 | WHIRLY 2 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | PGSC0003DMP400039765 |
| Entrez Gene | 102577630 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




