![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | PGSC0003DMP400041060 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 135aa MW: 15092.3 Da PI: 9.1852 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 87.5 | 7.6e-28 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
k+ien s rqvtfskRr g++KKAeELSvLCdae+ vi+fs+t++lye++s
PGSC0003DMP400041060 9 KKIENISSRQVTFSKRRSGLFKKAEELSVLCDAEIGVIVFSNTDRLYEFAS 59
68***********************************************86 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00432 | 1.3E-39 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 31.469 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 1.99E-40 | 2 | 77 | No hit | No description |
| SuperFamily | SSF55455 | 2.35E-31 | 2 | 77 | IPR002100 | Transcription factor, MADS-box |
| PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 6.8E-28 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 3.3E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 6.8E-28 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 6.8E-28 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0009555 | Biological Process | pollen development | ||||
| GO:0009910 | Biological Process | negative regulation of flower development | ||||
| GO:0048577 | Biological Process | negative regulation of short-day photoperiodism, flowering | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 135 aa Download sequence Send to blast |
MGRGKIEMKK IENISSRQVT FSKRRSGLFK KAEELSVLCD AEIGVIVFSN TDRLYEFASS 60 KSSMEKIVDR YNNSSHSIEH PIVENIVEPE LNSLKVEVAK LRKATGLSVA TSQKKRNPKI 120 ECTSNDSENL MILD* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5f28_A | 7e-20 | 1 | 89 | 1 | 87 | MEF2C |
| 5f28_B | 7e-20 | 1 | 89 | 1 | 87 | MEF2C |
| 5f28_C | 7e-20 | 1 | 89 | 1 | 87 | MEF2C |
| 5f28_D | 7e-20 | 1 | 89 | 1 | 87 | MEF2C |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | PGSC0003DMP400041060 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | HG975449 | 1e-83 | HG975449.1 Solanum pennellii chromosome ch10, complete genome. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_006351403.1 | 9e-70 | PREDICTED: MADS-box transcription factor 23 | ||||
| Swissprot | Q6VAM4 | 3e-33 | MAD23_ORYSJ; MADS-box transcription factor 23 | ||||
| TrEMBL | M1C6U9 | 7e-92 | M1C6U9_SOLTU; Uncharacterized protein | ||||
| STRING | PGSC0003DMT400060995 | 3e-69 | (Solanum tuberosum) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G51870.2 | 2e-35 | AGAMOUS-like 71 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | PGSC0003DMP400041060 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




